(data stored in ACNUC7421 zone)

EMBL: CP000821.PE104

CP000821.PE104       Location/Qualifiers
FT   CDS_pept        116896..118164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0104"
FT                   /product="three-deoxy-D-manno-octulosonic-acid transferase
FT                   domain protein"
FT                   /note="KEGG: slo:Shew_3707
FT                   three-deoxy-D-manno-octulosonic-acid transferase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34717"
FT                   /db_xref="GOA:A8FPE4"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPE4"
FT                   /protein_id="ABV34717.1"
FT                   /translation="MNRFIYSILLYLLFPLLVIYLAVRAIKSPDYRGRWGERFGLTSLK
FT                   GSDLLIHSVSMGETLAAIPLIKAIQQAHPQLSITVTTTSPTGSAEVTKAFGDSVQHCYL
FT                   PFDLPFSVRRFLKQVDPQYCIIMETELWPNLIHQASRCGIKLMLANARLSEKSAGKYQK
FT                   QITLSQPMLQSLDSIAAQSQQAADRFIALGVNADRVEVCGSLKFDLTIADDKREQAKAL
FT                   RQQWRAVTCPVWIAGSVHPGEFDAILAAHRHLLTIYPDALLIMVPRHPEKFDAAASKIS
FT                   ESGFTLARRSLKESVDDETQVLLGDTMGELLTFYGAADQAFVGGTIVENGGHNPLEPAA
FT                   LGLPVFVGPHHWDFAEITGLLNEAGALQLVSSAEELGTALVRNFEDKSAYQVASEAGLS
FT                   VVDANKGALQHQFDLANRLIAFE"
     atgaaccgtt ttatttattc aatattactc tatctacttt ttcctctgtt ggttatatat        60
     ttagccgtgc gtgccatcaa gagtcccgat taccgtggta ggtgggggga gaggtttggc       120
     cttacatccc tcaaggggag cgacctgctt attcattcag tctctatggg ggagactctt       180
     gcggccattc ctctgattaa agcgatccaa caagcgcacc ctcagcttag catcacagtg       240
     actacgacga gtccaaccgg ctctgccgag gtgacaaaag ccttcggtga cagcgttcag       300
     cactgttatc tgcctttcga tctgcccttt agtgttcgtc ggttcctgaa acaggtggat       360
     ccgcagtact gcatcattat ggagaccgaa ctgtggccaa acttgatcca tcaggcctct       420
     cgctgtggaa tcaagttgat gctcgccaat gcgcgtttat ctgaaaaatc ggccggtaaa       480
     tatcaaaagc agataaccct ttctcagcct atgttgcaga gtctggactc gatagcggct       540
     cagtcacaac aagctgcaga tcgttttatc gcactaggtg tgaacgcaga cagggttgag       600
     gtgtgtggca gcttgaagtt tgatcttacc attgccgatg acaagcgtga gcaggccaag       660
     gcattgcgcc aacaatggcg cgctgtaacc tgcccggtat ggattgcagg cagcgttcac       720
     cccggtgagt tcgatgctat cctggctgca cacagacatc tgttgacgat atacccggat       780
     gccctgctta tcatggtgcc acgtcatcca gagaagtttg atgcggcggc gtcgaagata       840
     tctgaatccg ggttcactct cgccagacgt agcttaaaag agagcgtcga tgatgagact       900
     caggtactcc tgggcgatac catgggagag ttattaacct tctatggcgc ggccgatcag       960
     gcatttgtcg gtggcacaat agttgaaaat ggcggtcata atccgctaga acctgcggcg      1020
     ctgggcctgc ccgtatttgt cggaccacat cattgggatt tcgccgagat cacgggcctg      1080
     ctcaacgagg caggagccct gcagctggtc tcgtcggccg aagagttagg cacagcgtta      1140
     gtgcgtaact ttgaagataa gtcggcatat caggtagcca gcgaagctgg gttaagtgtt      1200
     gttgacgcca acaagggggc gttacagcat cagtttgatc ttgccaatcg gttgatcgcc      1260
     ttcgaatga                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page