(data stored in ACNUC7421 zone)

EMBL: CP000821.PE105

CP000821.PE105       Location/Qualifiers
FT   CDS_pept        complement(119268..119990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0105"
FT                   /product="lipopolysaccharide kinase"
FT                   /note="KEGG: slo:Shew_3706 lipopolysaccharide kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34718"
FT                   /db_xref="GOA:A8FPE5"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022826"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPE5"
FT                   /protein_id="ABV34718.1"
FT                   /translation="MQIKQTSSGAIAYCDATPETISVPWFTFDYWQSQGAITGSSKGRY
FT                   TTWFVKPNMAETDKSEWVLRHYYRGGLMEKISKDSYFYTGLKNTRAVAELSLLELLYSE
FT                   GFEVPRPIAANVERNGLYYRADIIIERVEGAQDLVAQLSKSPMSDLQWQQLGACIAKFH
FT                   QRGVYHADLNAKNILITPDKFYLIDFDRGEIRTPNPKWQGANLERLLRSFRKELAKLPT
FT                   LAFNETNWQSLMQGYSNP"
     atgcagatta aacaaacctc atcaggcgct atcgcatatt gcgatgccac gcctgaaacc        60
     atctcagtgc cgtggtttac cttcgattac tggcagagcc aaggtgctat aacaggttca       120
     tcaaagggcc gatacaccac ctggtttgtt aaacccaata tggctgagac agacaagagt       180
     gaatgggtgc tgcgccacta ctatcgcggt gggctgatgg aaaagatcag caaggactcc       240
     tatttttaca ccggtctgaa aaacaccaga gcggtggctg agttatcact attagaattg       300
     ctgtatagcg aaggatttga agtcccccgc cccatcgccg ccaacgtaga gagaaacggt       360
     ctctattatc gcgccgatat cattatcgaa cgcgtggagg gggcccaaga tctggtggcc       420
     caactgagca agtcgccgat gtcagatcta caatggcagc aactaggtgc ctgtatcgct       480
     aaattccacc agcgaggggt ctatcatgcc gatctcaacg ccaagaatat ccttatcaca       540
     ccagataaat tctaccttat cgacttcgac agaggtgaaa ttcgcacgcc aaaccccaag       600
     tggcaaggtg ccaacctgga gaggttgtta cgctccttca ggaaggagct ggctaagcta       660
     ccaactttag ccttcaatga gaccaattgg caaagtttga tgcagggata ttctaaccct       720
     tag                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page