(data stored in ACNUC7421 zone)

EMBL: CP000821.PE11

CP000821.PE11        Location/Qualifiers
FT   CDS_pept        complement(12470..13456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0011"
FT                   /product="UreA amidolyase related protein"
FT                   /note="KEGG: slo:Shew_0007 UreA amidolyase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34624"
FT                   /db_xref="GOA:A8FP51"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP51"
FT                   /protein_id="ABV34624.1"
FT                   /translation="MTKRNSIQVLKAGMHSSVQDLGCTGYRHLGITTGGALDRHALILA
FT                   NRLLGNSDASAGIELTSGIVELKFNCDTWFVLTGANYRISIGQRDIWCNWRNKIRAGET
FT                   LTLRGPKSGMRAYLALEGGIVDGIEGEIRDGSPETNNKLRLKSDSLLGDRFSGVLGAVL
FT                   KDGDRLALGQAGAISKPIGAVQRGYSNEIRALPGPEMPLFSEESKKAFWNSSWQLTNES
FT                   NRMGARLSGITLSLAQQQDMESHAVMPGAVQVPPAGQPIVLLADSQTTGGYPKIATVIE
FT                   ADLWKLAQTRPGEEVRFVHVSPNQADDANYEWEEYFYRLQRAIEANG"
     atgactaaaa gaaatagtat ccaagttctc aaggctggta tgcactcttc ggtacaggat        60
     ctcggctgca caggctatcg ccatctggga ataactacgg gcggcgcact ggatcggcac       120
     gccttaatac tcgcaaatag actcctcggc aatagcgatg catcggcggg cattgagcta       180
     acctccggta tagttgaact taaatttaac tgcgacacct ggtttgtgtt aaccggagcg       240
     aactaccgaa tatctattgg ccaacgcgac atctggtgta actggcgaaa taaaataaga       300
     gcgggcgaaa ccctcaccct gagaggacca aaatcaggta tgcgtgccta cctcgctctc       360
     gagggcggga ttgtggatgg aatagagggt gaaatacgcg atggtagccc tgagacaaat       420
     aacaaattac gactcaagtc ggactcactc ttaggtgaca ggttttccgg tgtcttaggc       480
     gctgtgctta aggatggaga tagattagcg ttaggtcagg ccggagcaat atcgaaacca       540
     atcggtgctg tgcagcgggg atattcgaat gagatccgtg cccttcccgg accagagatg       600
     ccactgtttt cggaagaatc aaaaaaggcc ttctggaata gctcctggca actcaccaac       660
     gaaagcaaca ggatgggagc cagactatcc ggaataacat tatccttagc gcagcaacaa       720
     gatatggaat cacacgccgt catgccggga gcggttcaag tccctcccgc cgggcaaccc       780
     atagtattac tcgccgactc acaaaccacg gggggttatc ctaaaatagc gaccgttatt       840
     gaagccgatc tctggaagtt agcccaaacc agacccggag aagaggttcg atttgttcat       900
     gtgagcccaa atcaggctga tgatgccaat tacgagtggg aagagtattt ttaccggctt       960
     caacgagcaa tagaggccaa tggttaa                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page