(data stored in ACNUC7421 zone)

EMBL: CP000821.PE112

CP000821.PE112       Location/Qualifiers
FT   CDS_pept        complement(125937..127007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0112"
FT                   /product="Glycerol dehydrogenase-like protein"
FT                   /note="KEGG: chy:CHY_2583 putative glycerol-1-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34725"
FT                   /db_xref="GOA:A8FPF2"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR032837"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPF2"
FT                   /protein_id="ABV34725.1"
FT                   /translation="MSDFTRKLNTRHLEFPAQLLVEKNAIANTPLLSNLPLSQGVLLAI
FT                   DDGVKTLAEQVLPHLWASKSCTTHVIEKADFTNVSQIDAICAERQIETVVAFGGGKVLD
FT                   VCKRLASLRHIELIVIPTALSSDCVSSPIAVIFDESGKKLSLPAAIPNVIIVDTKLCSQ
FT                   APRRLTQAGIGDLLSNYCALLDMNYAKDRADVDGFSYLLAKSAANEIVGMQHLSLTDQA
FT                   VITQLAEGLILSGLAMGFSGDSRPCSGAEHLISHALDFLNLGDGLHGEQVALGMKFCHH
FT                   LRLLLNLPALNPSVLACIDGFNIRSTPDSLNISKNEFFEALAISPEMRKGRMTFLEKQN
FT                   SIPKAQLEKAYINAFE"
     ttgtcagact tcacaaggaa gctcaacact cgacacttgg agtttcctgc ccagttgctc        60
     gttgagaaaa atgcgatagc aaatacgcct ctgttatcaa acttaccact ttcccaaggg       120
     gtactgctgg ccatagatga tggtgtgaag acattggctg aacaggtttt accccattta       180
     tgggccagta aaagctgcac tacacatgta atagaaaaag ctgactttac taatgtatct       240
     caaatcgatg ccatttgtgc agagcgacaa atcgagaccg tcgtggcttt cggtggagga       300
     aaagttctcg atgtatgcaa acggttagca agcctacgtc atattgaact cattgtaata       360
     ccgacagcac tttccagcga ttgtgtctct tcgcctattg ccgtaatttt tgatgaatca       420
     ggaaaaaagc tcagcctgcc tgctgcaatt cccaatgtca tcatcgtcga tacaaagctc       480
     tgctctcaag caccgaggcg ccttactcaa gcaggtattg gcgatcttct ttcaaactat       540
     tgtgcattac ttgatatgaa ctatgccaaa gacagagccg atgttgatgg tttttcctat       600
     ctgctcgcca aatctgcggc aaatgagatt gtgggcatgc agcacctgtc actcacagat       660
     caagctgtga tcactcagct cgccgaagga cttattttgt ctgggttggc gatgggattt       720
     tcgggagact ctcgcccctg ttccggcgca gaacatttga ttagccatgc attggatttt       780
     cttaaccttg gagatggttt acatggcgaa caggtagcac tgggaatgaa gttttgccat       840
     cacctaagat tactcctgaa tctaccagcc ctaaatcctt cagtattagc atgtattgat       900
     ggcttcaata ttcgcagtac ccccgattca ttaaacatca gcaaaaatga attttttgaa       960
     gcattagcta tcagccctga aatgcgcaaa ggtcgtatga catttttaga gaaacaaaac      1020
     tctataccta aggcccaact agaaaaagca tatataaatg catttgaata a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page