(data stored in ACNUC7421 zone)

EMBL: CP000821.PE113

CP000821.PE113       Location/Qualifiers
FT   CDS_pept        complement(127008..127427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0113"
FT                   /product="cytidyltransferase-related domain"
FT                   /note="KEGG: sfr:Sfri_3930 cytidyltransferase-related
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34726"
FT                   /db_xref="GOA:A8FPF3"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPF3"
FT                   /protein_id="ABV34726.1"
FT                   /translation="MSKKVLVVGVFDLFHRGHVEFLQKASEFGDELIILINGDEMTEKY
FT                   KRRPIYSEDDRATILNALSCVSQVEVTNSFDIKPIIEKYNIDVIVHGDDWEHESYLAQI
FT                   RCTQSYLDEQGVSLAYTEYHKSVSTSTLLKQIKEA"
     atgtctaaaa aagttttagt ggtcggtgta ttcgatcttt ttcatcgagg tcatgtcgag        60
     ttccttcaga aagcctcaga atttggtgat gaactcatta tattgattaa tggcgatgag       120
     atgaccgaaa aatataagcg gcgtccaata tatagtgaag atgatagggc aactattctc       180
     aatgcgctca gctgtgtttc acaggtcgaa gtcaccaata gttttgatat caaacctatt       240
     attgaaaaat acaatatcga cgtcattgtt catggtgatg actgggaaca tgaatcatat       300
     ttagcacaaa ttcggtgcac tcaatcatat cttgacgagc aaggtgtaag cctagcctat       360
     actgaatatc ataaatctgt cagtaccagc accttactaa aacagatcaa ggaggcataa       420
//

If you have problems or comments...

PBIL Back to PBIL home page