(data stored in ACNUC7421 zone)

EMBL: CP000821.PE116

CP000821.PE116       Location/Qualifiers
FT   CDS_pept        129317..130810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0116"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3691 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34729"
FT                   /db_xref="InterPro:IPR026950"
FT                   /db_xref="InterPro:IPR038636"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPF6"
FT                   /protein_id="ABV34729.1"
FT                   /translation="MMENLKSFGVRAFAILSLFTSFISVSAPWVDTSDIYLRADIQALA
FT                   DEGVITVPVNTYPLMWAGIGADLSKVEPSVLPPSVAQAFARVNYYYRNAVENRGNTRIK
FT                   AAAATDAARFQHFGSDYSEQGELQASYEYMGDRFAFKASASANYDPSDEKEFRYDDSYM
FT                   AVILGNWIFTAGAVEQWWGPGFDSSMHRSNNARPLPSVMISRNNAAAFETPWLSWLGPW
FT                   TLTAGVSRLEEERAVANPLLWNFRSSLRPFRQLEVGFSWTTQFCGEGEECSWESALKSI
FT                   TGQRDCRGAGEAGCTNYGNQMAGYDIRFSDTWFDIPFGVYYEKTCEDAKGSTPWDIVDC
FT                   GHAAGVDTRFNFDNAQYKLFFEYTDTMVACGEDDNVFNCMYEHSIYKSGSRYYDKAYGS
FT                   TYDSDAKVYVLGLIGQFADSRGITSLLRYAQLNKDGSSPAHGWAPQPAKEDLLMLELSY
FT                   RMPIWKGMMSVGGTVSQSEFEVEDKQTDATLFGTYEYRF"
     atgatggaaa atttaaagtc atttggtgtg cgggcttttg caatactcag cttatttacc        60
     tcctttatct ctgtatccgc cccctgggtg gacacttctg atatctatct gcgtgccgat       120
     attcaggctc ttgccgatga aggtgtgatc acggttcccg ttaataccta tccgctgatg       180
     tgggccggta tcggtgctga tctgagcaaa gttgagccct cggtattgcc cccttcggtg       240
     gcgcaagcct tcgcccgggt gaactattat tatcgaaatg cggtcgagaa tcgtggcaat       300
     acgagaataa aagcggcggc ggcgaccgat gcggctcgtt ttcaacattt tggctccgat       360
     tatagcgagc agggtgagct gcaagcgtca tatgaatata tgggggatcg ctttgccttt       420
     aaggcctcgg cttcagctaa ctatgatccc agtgatgaaa aagagttcag atacgatgat       480
     tcctatatgg cggttatctt aggcaactgg atctttaccg ccggcgccgt agagcagtgg       540
     tgggggcctg gattcgactc atcaatgcat agatcaaata atgcacggcc gctgccttcg       600
     gtgatgatta gccgtaataa cgcggctgca tttgaaactc cctggttatc ctggcttggg       660
     ccatggactc ttactgcagg tgtgagtcgt ttagaggagg agcgtgcggt cgctaatccg       720
     ctactgtgga acttccgtag ttcactgcgt cccttcagac agttagaggt aggtttttcc       780
     tggacgaccc agttctgtgg tgaaggcgaa gagtgctcct gggaaagtgc cttgaagtct       840
     ataaccggtc agcgagattg tcgcggtgcg ggcgaggcgg gctgtaccaa ctatggtaat       900
     cagatggcgg gttacgatat ccgtttcagc gatacctggt tcgatattcc atttggtgtc       960
     tattatgaga aaacctgtga ggatgccaag ggctcaactc cctgggatat tgtcgattgt      1020
     ggtcacgcag cgggtgtaga tactcgcttt aattttgaca atgctcagta caagctcttt      1080
     ttcgagtaca ctgataccat ggtcgcttgc ggagaagatg ataacgtctt caactgcatg      1140
     tatgaacact caatatacaa gagcggttct cgttattatg ataaggcgta tggcagcacc      1200
     tatgacagcg acgctaaagt ctatgtgttg ggcttgattg gacagtttgc tgatagtcgc      1260
     ggcatcacct cgctattacg ttatgcccag ttgaacaaag atggctccag tccggctcat      1320
     ggctgggcgc cccagcctgc gaaagaagat ctgttaatgc tggagcttag ctatcgtatg      1380
     cctatctgga aagggatgat gagtgtcggt ggtacagtgt ctcaatcgga atttgaggtc      1440
     gaagacaaac aaaccgatgc gaccctgttc ggcacctacg agtatcgttt ctaa            1494
//

If you have problems or comments...

PBIL Back to PBIL home page