(data stored in ACNUC7421 zone)

EMBL: CP000821.PE118

CP000821.PE118       Location/Qualifiers
FT   CDS_pept        complement(131773..132255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0118"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_0076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34731"
FT                   /db_xref="GOA:A8FPF8"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPF8"
FT                   /protein_id="ABV34731.1"
FT                   /translation="MALSRKKWNNVIIIASLLMITILTLLDDKTSQLPDDAHPLFDNTS
FT                   PLAQLQVNELWLNKGSSNWQCHPKILNCQVWAKAWSEIQLSPLVDQQELFKHSSADTPK
FT                   EVIIVIANSEQAQPWSWYEKLGLLKSPANNWYLIPPSQREGLSPIIKISAASNTDS"
     atggctctat ctcgaaaaaa atggaacaac gtaatcatta tcgcttccct actaatgatc        60
     accatactca ccctattaga tgacaaaaca tctcagctac ccgatgatgc tcacccactt       120
     ttcgataaca cttctccttt agcgcaacta caagtgaacg aactctggct caacaaaggc       180
     agtagtaact ggcaatgcca cccaaaaatt ctcaattgcc aggtatgggc aaaagcctgg       240
     agcgagatac agctatctcc actcgtcgat cagcaagaac tgtttaaaca ttccagcgcc       300
     gacaccccca aagaggtcat catagttatc gccaacagtg agcaagcgca gccatggagc       360
     tggtatgaaa agctgggact actgaaatcc ccggcaaata actggtacct gatccctccc       420
     agtcaaagag aagggctttc accgatcatc aaaatatccg cggcatcaaa taccgatagc       480
     taa                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page