(data stored in ACNUC7421 zone)

EMBL: CP000821.PE119

CP000821.PE119       Location/Qualifiers
FT   CDS_pept        complement(132415..133401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0119"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /note="KEGG: slo:Shew_3688 molybdenum cofactor biosynthesis
FT                   protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34732"
FT                   /db_xref="GOA:A8FPF9"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPF9"
FT                   /protein_id="ABV34732.1"
FT                   /translation="MSLIVDTFGRKVEYLRLSVTDRCDFRCVYCMSEDPCFLNREQVLS
FT                   LEELAWVGQAFTELGVRKIRLTGGEPLVRTDCDQLVKLLGDLPGLSELSMTTNGSRLTK
FT                   FAEKMRGSGLGRLNISLDTLKPELFTELTRNGKLERVIEGIDAAKAAGFTRIKINAVIL
FT                   RGQNDDEVLDLIEFCRGRELDIAFIEEMPLGIIDERKKSRHCSSEEVKSIISKRYELSV
FT                   SNKRTGGPARYYTMPGSSIHVGFISPHSNNFCHECNRVRVTVEGRLLLCLGNEHSVDLK
FT                   AILREFPGDIEKLKTAILDAIKLKPKEHVFGPEGDVQILRFMNATGG"
     atgagtttga tcgtcgatac cttcggacgt aaggtagaat atttgcgtct ttctgttact        60
     gacagatgtg attttcgttg tgtttactgc atgagcgaag acccctgttt tctcaatcgt       120
     gaacaagtcc tcagcttaga ggagctggcc tgggtgggtc aggcatttac tgagctgggt       180
     gtaagaaaaa ttcgcctcac cggcggcgaa cctttggtac gcacagactg tgaccaactg       240
     gtcaaactgc tcggcgacct gccagggtta tcggagctat cgatgaccac caatggttcc       300
     cggcttacca agtttgctga aaagatgcgt ggctcgggtc ttggcaggct caatatcagc       360
     ctggatacat taaaacctga actcttcacc gaattgaccc gtaatggcaa acttgagcgt       420
     gtcattgagg gtatcgatgc cgctaaagcc gctggcttta cacgcatcaa gatcaatgcg       480
     gttattctaa gaggccaaaa tgatgatgaa gtcctggact tgatcgaatt ttgtcgtggc       540
     agagagttgg acatcgcttt catcgaagag atgccactcg gcattatcga tgagcgtaag       600
     aagagtcgtc actgcagcag tgaggaggta aaatcaatta tctcaaagcg gtatgaactc       660
     agtgtatcga acaagcgtac cggtggaccc gcgcgttact acaccatgcc gggtagctct       720
     attcatgtgg gcttcatctc tccacacagc aacaacttct gccatgaatg taaccgcgtt       780
     cgcgtcactg tagagggccg tttgttactc tgtttaggta acgaacactc cgtcgatcta       840
     aaagccatcc tcagagaatt tcccggtgat atcgagaagt taaaaaccgc cattttagat       900
     gccatcaagc ttaaacctaa agagcatgtt tttgggcccg agggcgatgt gcagatctta       960
     cgctttatga acgcgacagg cggatag                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page