(data stored in ACNUC7421 zone)

EMBL: CP000821.PE12

CP000821.PE12        Location/Qualifiers
FT   CDS_pept        complement(13485..14171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0012"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_I0230 conserved hypothetical protein
FT                   TIGR00370, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34625"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP52"
FT                   /protein_id="ABV34625.1"
FT                   /translation="MTTEQTPKVFRLGEGAVVIDSTNYFPEVSRLSIQRKIWWLADRCR
FT                   QTDEFIDIVPGMNNLTLFVKSNNRINYWLAQLGTLWLQAKEMSLSGRNVEIPLVYGGEF
FT                   GPDLERLAKYHQLSCKEVVRRHSNGKYTVLFLGFQPGFPYLDGLDSSLFTPRLAVPRLS
FT                   IPAGSVGIGGNQTGIYPASAPGGWQLIGRTNMPLFTPESIGSPTLVEPGDTVQFIPVTS
FT                   LVFSAK"
     atgacaacag agcagactcc taaggttttt aggttggggg aaggtgcagt agttatagac        60
     agcaccaatt actttccgga ggtatcgaga ctcagtatcc aacgcaaaat ttggtggttg       120
     gccgatcgat gcagacagac agatgaattt atcgatatcg tccccggcat gaacaacctc       180
     accctctttg tgaagagtaa caatcgaata aattattggt tagctcaatt aggcacactc       240
     tggctacagg cgaaagagat gagtctcagt ggccgaaatg tagagatccc tcttgtctat       300
     gggggagaat ttggtccgga tttggaacgg ctggccaagt atcaccaact cagttgtaag       360
     gaggtagtgc ggcgacattc aaatgggaaa tataccgtcc tgtttctggg atttcagcca       420
     ggcttcccct atcttgacgg actggactca agtctgttta cccccaggtt ggcagtgcca       480
     agattatcaa ttcccgctgg ctccgttgga ataggtggca atcagacagg tatttatccg       540
     gcgtccgccc ccggaggctg gcaacttatt ggccgcacca atatgcccct gtttactccg       600
     gagtccatcg gctcaccaac acttgtcgaa cccggtgata ccgttcaatt tattccggtg       660
     acaagtctgg tgtttagtgc caaataa                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page