(data stored in ACNUC7421 zone)

EMBL: CP000821.PE120

CP000821.PE120       Location/Qualifiers
FT   CDS_pept        complement(133479..135284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0120"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B"
FT                   /note="KEGG: slo:Shew_3687 molybdopterin-guanine
FT                   dinucleotide biosynthesis protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34733"
FT                   /db_xref="GOA:A8FPG0"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR012182"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPG0"
FT                   /protein_id="ABV34733.1"
FT                   /translation="MSIPFTNPLTIPVLGFCAYSGTGKTTLLKKLIPELNRRGVKLAVI
FT                   KHAHHNFDVDIPGKDSYEMRKAGARQMLVASHVRWALMTEDAVGDDPKLPHLLQQIEQD
FT                   SVDIVLVEGFKKLELPKIELHRAAHDKPFIHTHDKNIQAIACCDETELPGDLRRLDIND
FT                   VAQIADFVIEYANNWQPASVNLPLSPAPECGCEVDTSKTLSVRQGIDKILSYVNPITAG
FT                   EVLPLDELNSRVLAEDAISPVDVPQQTNSAMDGYAFKHSSPMLASYKIVADVMAGHQYS
FT                   KVLQTGEAVRIMTGATVPAGADTVQMKELATELEGQVSFQGDITLGQHIRLAGEDIAKG
FT                   HTALAANARLQAPEQGLLASLGFGQLPVFKRPRVAIFSTGDEVCQPGEPLQPNCIYDSN
FT                   RFTIKSMVRKLGCEVIDLGIIHDSEDALADALSQAAVDADVVISSGGVSVGDADFIKLA
FT                   LERVGQINFWRINMRPGRPLAFGQIGDSLFFGLPGNPVAVMVSFMQFVQPALRKLAGEN
FT                   SWAPTMVPAITDTGLRSRVGRTEFTRGIYHLGTDGKLHVTTTGAQGSGMLSSMVKGNCF
FT                   IVISEKDDQLNPGDTVYIQPFADLL"
     atgagcatcc cttttaccaa tccgttaaca attcctgttc tcggattttg tgcctatagt        60
     ggcacaggaa agaccacgct attaaagaaa ctgatccccg aattaaatcg caggggggtg       120
     aagctggcag tcataaagca tgctcatcat aacttcgatg tggatattcc gggtaaagac       180
     agttacgaaa tgcgtaaggc tggtgctcgc cagatgctgg tcgcctcaca cgtaagatgg       240
     gcactgatga cggaagatgc cgtcggggat gaccctaagc tacctcacct gctccagcag       300
     attgaacaag atagtgtcga tatcgtattg gtggaaggct ttaaaaaact cgaactccca       360
     aagattgaac tccatcgtgc cgcccacgac aaacctttca tccataccca tgacaagaac       420
     attcaggcaa tagcttgctg tgatgaaact gaacttcctg gtgacttgag acgactggac       480
     atcaatgatg tcgctcaaat tgccgacttc gttatcgagt atgctaacaa ctggcagcca       540
     gcaagtgtca acttaccgct ctctccggca ccagagtgtg gctgtgaggt cgataccagt       600
     aagaccctgt cggtaagaca aggcatagat aagatcttat cttacgttaa tcccatcaca       660
     gctggtgaag tgctccctct ggatgagctc aacagccggg tactcgccga agatgcgata       720
     tctcctgtcg atgtacctca acagaccaat tcggccatgg acggatacgc cttcaagcac       780
     tccagcccca tgctagccag ttataagatt gtcgccgatg tcatggcggg acatcaatac       840
     tcgaaggtgc tacagacagg tgaagcggta cgtatcatga caggtgccac ggtacccgca       900
     ggagccgaca ccgttcagat gaaggagttg gccacagagc tggaaggtca ggttagcttt       960
     cagggtgata tcaccctggg acaacatatc cgactcgcag gcgaggacat agctaaaggc      1020
     catacggccc tggccgccaa cgctcgactg caagcaccag aacagggact actggcctca      1080
     ctgggttttg gccagctgcc ggtattcaaa cgccccagag tcgccatttt ctcaaccggt      1140
     gatgaagtgt gtcagcccgg agagccacta caaccgaact gcatctatga ctcaaaccgc      1200
     tttaccatca aatctatggt cagaaagttg ggctgtgaag tcatagatct tgggatcatt      1260
     cacgactcag aagatgcact tgccgatgca cttagccaag ccgcggtcga tgccgatgtg      1320
     gtgataagct ccggcggtgt atccgtcggc gatgccgatt ttatcaaact ggcactcgag      1380
     cgagtcggcc agattaactt ctggcgtatc aatatgcgac cgggacgacc actggccttc      1440
     ggccagattg gcgatagcct cttcttcggc ctgcccggta acccggttgc ggttatggtc      1500
     tcctttatgc aatttgtaca acctgcactg agaaaattag ccggagaaaa cagttgggca      1560
     ccgactatgg tacccgcgat cacagataca ggtcttcgta gccgtgtggg tcgcaccgaa      1620
     tttaccagag gcatctatca cttaggtacc gatgggaaac tacatgtcac gacgacaggc      1680
     gcacaaggtt cagggatgtt gagctctatg gtaaaaggaa actgtttcat cgttatcagc      1740
     gaaaaagatg atcagttaaa tcctggtgat accgtttata ttcaaccttt tgccgatcta      1800
     ctctag                                                                 1806
//

If you have problems or comments...

PBIL Back to PBIL home page