(data stored in ACNUC7421 zone)

EMBL: CP000821.PE121

CP000821.PE121       Location/Qualifiers
FT   CDS_pept        complement(135299..135889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0121"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A"
FT                   /note="KEGG: slo:Shew_3686 molybdopterin-guanine
FT                   dinucleotide biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34734"
FT                   /db_xref="GOA:A8FPG1"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FPG1"
FT                   /protein_id="ABV34734.1"
FT                   /translation="MSLQIDAVILAGGMARRMGGNDKGLVELQAQPMIKHAIDRIKPQV
FT                   REILINANRNQTRYAEFGYQVISDEDSGYLGPLAGMITAMGQTQAKYLLVVPCDCPLLP
FT                   ADLVERMLSQLEKENADLAVASDGKREQPVVLLLKPELRDSMKAFLDAGERKIDFWYAK
FT                   HNCAVADFSDQPNAFVNVNTPEQKQQLSEAIAK"
     atgtcattgc aaattgatgc agttatttta gccggaggca tggccaggcg catgggggga        60
     aatgacaaag gtttagtcga actccaggca caacctatga taaaacacgc catagatcgc       120
     ataaaaccac aagttagaga gatcctgatc aacgcaaacc gtaaccaaac ccgttatgct       180
     gagttcggct atcaagttat cagtgacgaa gattctggtt atcttgggcc gctagcagga       240
     atgatcactg cgatggggca aacacaggcc aagtatcttc ttgtcgttcc ttgtgattgt       300
     ccgcttttgc cggctgacct tgtcgagcgc atgctctccc aattagagaa agaaaatgcc       360
     gaccttgcag tagcaagtga cgggaagcgc gaacaacctg tagtactact tttaaagccg       420
     gaattaagag actcgatgaa agccttctta gatgctggcg aacgtaaaat cgacttttgg       480
     tacgctaaac ataactgcgc cgtagctgac ttttcagatc agccgaacgc ctttgttaat       540
     gtgaatacgc cagaacaaaa acaacaactt tctgaggcaa ttgccaaata a                591
//

If you have problems or comments...

PBIL Back to PBIL home page