(data stored in ACNUC7421 zone)

EMBL: CP000821.PE122

CP000821.PE122       Location/Qualifiers
FT   CDS_pept        complement(135873..136592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0122"
FT                   /product="ABC transporter-related protein"
FT                   /note="KEGG: slo:Shew_3685 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34735"
FT                   /db_xref="GOA:A8FPG2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPG2"
FT                   /protein_id="ABV34735.1"
FT                   /translation="MVKLVANNLEMKFGERHIFSVDRLQLSQGQTIHLQGDNGCGKTTL
FT                   MKLLAGLISPSRGAITTEGFEPLPWWRSNALLGKAVYLHQHPYLFDGSVEYNLSYPHPF
FT                   CNMTKQQLSDRTQTAIEMAELTHLKNQAASSLSGGEKQRLAIARAWIMQPKLLMLDEPT
FT                   SNMDRFSQDLVLAMISDLQQLGTGMLISSHQSCVLTSLCNQTWVIENQHIMSSSTADNI
FT                   PASAPINLQEPRYVIAN"
     atggtcaaat tagtcgctaa taatctagag atgaagtttg gtgaaagaca tatattcagt        60
     gtcgacaggc ttcagttgtc tcagggacaa acgatacacc ttcagggcga taacggttgt       120
     ggaaagacca ccctgatgaa actgcttgcc ggtctgatat ctcccagcag aggggccata       180
     acaactgaag gcttcgagcc actgccatgg tggcgttcca atgccttgtt aggcaaagcc       240
     gtctatctac atcaacatcc gtatctgttc gatggcagcg tcgaatataa tctgagttac       300
     cctcatccgt tttgcaacat gacaaaacag caactgagtg atcgcaccca aactgcaatt       360
     gagatggctg agttaactca tctcaaaaac caagcggcat cgagcctatc gggtggtgaa       420
     aaacaacggc tcgctatcgc cagagcctgg ataatgcagc ctaagttatt aatgttagat       480
     gagcctacat ccaatatgga caggttttca caagacttgg ttttggccat gatctccgat       540
     cttcaacagc ttggaacggg aatgttaatc agtagccacc aatcttgtgt gctaaccagt       600
     ttatgcaatc aaacctgggt cattgaaaat caacatataa tgtcatcttc cacggcggac       660
     aatattccag cctcagctcc aataaatcta caggaaccaa gatatgtcat tgcaaattga       720
//

If you have problems or comments...

PBIL Back to PBIL home page