(data stored in ACNUC7421 zone)

EMBL: CP000821.PE123

CP000821.PE123       Location/Qualifiers
FT   CDS_pept        complement(136595..137302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0123"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="KEGG: slo:Shew_3684 binding-protein-dependent
FT                   transport systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34736"
FT                   /db_xref="GOA:A8FPG3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPG3"
FT                   /protein_id="ABV34736.1"
FT                   /translation="MNEGWLALLQQALGLLFSLDPDVWSIVSVSFSVSFAALGITLLPS
FT                   MILGFMLAFGRFPGRWFVTNLIQTLQSIPTVVIGLLVYLMLTRMGPLGDLRWLFTQKGM
FT                   ILGQMMICAPVLVAMSQAAFTSVDRRAWETSRTLGASWFRGILTVCRELKVPLLMAIVA
FT                   GFSRILTEVGCSMMVGGNIADVTRNIPTAIALETSKGDFAQAIALGLVLLILSLVLNFT
FT                   LGALRGKAEPRSH"
     atgaatgaag gctggttagc ccttttacag caggccttag gcctgctgtt ttcattggac        60
     cctgatgtgt ggtccattgt atctgtatct ttttctgtat cttttgcggc tctggggatc       120
     accctgctac cttcgatgat attgggattt atgctggctt ttgggcgctt tcccggtcgc       180
     tggtttgtca ccaatttaat tcagactctc cagtcaattc ctaccgtcgt cattggcctg       240
     ctcgtctacc ttatgctgac ccgcatgggc cctctgggtg atcttagatg gctatttact       300
     caaaaaggca tgattttagg ccagatgatg atctgcgctc ccgtgttagt cgcaatgagt       360
     caagcggcct ttaccagcgt cgaccgtaga gcctgggaaa catcacgcac ccttggcgcc       420
     tcttggttca ggggcatctt gacggtctgt agagagctta aagtcccgtt actcatggcg       480
     atcgtggctg ggtttagccg catcttgact gaagtgggtt gctccatgat ggtcggtgga       540
     aatattgcgg atgttacccg aaacatccct accgctattg cactcgagac cagtaaaggc       600
     gactttgccc aggcaatagc cctaggtctt gttctgctca tcttatctct cgttcttaac       660
     tttactttag gggcgctcag aggcaaagca gagccgagga gccattag                    708
//

If you have problems or comments...

PBIL Back to PBIL home page