(data stored in ACNUC7421 zone)

EMBL: CP000821.PE124

CP000821.PE124       Location/Qualifiers
FT   CDS_pept        complement(137397..138209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0124"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /note="KEGG: slo:Shew_3683 extracellular solute-binding
FT                   protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34737"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPG4"
FT                   /protein_id="ABV34737.1"
FT                   /translation="MLNLKSIFSFALAATLVTGMPAQAEEIIKLATTTSTENSGLLKNL
FT                   LPKFEAESGYKVQVIATGTGKALKLARQGDVDVIMTHAPAAEAKFVDEGFGLLPRGIME
FT                   NDFVILGPKNDPAKIRNSKTVEEAFAKIAESGAIFVSRGDNSGTNMKEMIIWNNAKVDA
FT                   SFAGYKSVGQGMGKTLLMANELQGYTLSDRGTFVAYKAKLDMAIDFDGGQALANPYQIM
FT                   LINPAKYPDLNHKGARAFSDWLIGAEAQGMINSYKVQGEQLFKATYSE"
     atgttaaacc ttaaatctat cttcagcttt gcattagccg cgacgctagt cacaggtatg        60
     ccggcacaag ccgaagagat tataaagtta gccacaacaa caagtactga gaactcaggc       120
     ttattgaaaa acttattacc caagtttgaa gccgaaagcg gctacaaagt tcaggtcatt       180
     gcaaccggta ccggtaaggc cctcaagctt gcccgtcaag gcgatgtcga cgtcatcatg       240
     acacatgccc ctgcagcaga agctaaattt gtagatgaag gtttcggtct tttgcctcgc       300
     ggcataatgg aaaacgattt tgtgatcttg ggccctaaaa atgacccggc taagatccgt       360
     aacagtaaga cagttgaaga ggcatttgct aaaatagccg aatcaggcgc catttttgtt       420
     tctcgtggag acaactccgg cacaaacatg aaagagatga tcatctggaa caatgctaag       480
     gtcgatgcct cttttgccgg ttataagtct gttggtcagg gaatgggtaa aaccctattg       540
     atggcaaacg aacttcaagg ttacacactt tctgatcgtg gtaccttcgt ggcctacaag       600
     gcaaagctgg atatggctat cgattttgat ggcggccagg cattagcaaa cccataccag       660
     atcatgttaa ttaaccctgc aaaataccct gatctaaacc acaaaggcgc cagagccttt       720
     agtgactggt tgattggcgc cgaagctcaa ggcatgatca atagttataa agttcaaggt       780
     gagcaactat ttaaggcaac ttatagcgaa tga                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page