(data stored in ACNUC7421 zone)

EMBL: CP000821.PE126

CP000821.PE126       Location/Qualifiers
FT   CDS_pept        139868..141985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0126"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: slo:Shew_3681 integral membrane sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34739"
FT                   /db_xref="GOA:A8FPG6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPG6"
FT                   /protein_id="ABV34739.1"
FT                   /translation="MSFFPRIFGINWQQMQAKVRYRILILTLLPILLTLVSLVFITIYW
FT                   NISYTGKQLFMKVKADLTVANNTLISVQKSQEKQLELVMESWEFQNDFRLFDGNKNSYR
FT                   KQIDHLLDSKKQLLNLDFLRLVSVSEAAADPDLRVMLQKVKGDSAYSGLMVLEPKRLAL
FT                   IDPEMVKTASIPLVETPRSQKPTKKVEDRGLLSRSLLPVPDAEGNVAWYLDGGILFNRD
FT                   IRIVDHIRDLVYDKGTLPERSIGTVTIFLDNTRISTNVPLHFFPQGGEVEGRALGSLVS
FT                   EEVKQKVFSQGMLWVDRAFVFNDWFISAYAPLEDVQGKRIGMIYTGFSESPFIHNYLLN
FT                   IIELGTILMLVLLVSGLLVYRGAYSLLQPIERIHHVVKAVQSGRNLRIGSLGLERDNEL
FT                   SNLAEQFDRMLDLLQRRNSQIQAAAEQLEVKVEERTRSLQEKTEELQNNVALLNETRQQ
FT                   LVTNEKLTALGELTAGIAHEINNPTAVILGNMELMKYELGDRAEDVEEEIDLVIQQVGR
FT                   ISTIIRSLLQYSRPGEFNAPLEMHQLTPIIEEMLVLVRHSIQEQKVILNQELNASYPIE
FT                   VNRPQLLQVLINLVVNAAHAMDEEGRIWIRTYDWVQRGEPIGVKIEIEDEGKGIPQEQL
FT                   SRIFDPFYTTRADGTGLGLSLSYGIIKRIGGTIEVSSTVGKGTLFTIGLYHKAKEEQVD
FT                   TPYEGLHFNGH"
     gtgtcctttt ttcctcgtat ttttggtatc aattggcagc agatgcaagc taaggttcgt        60
     tatcgaattt taatccttac cttgctgccg atcctgctta ccttagttag cttagtattt       120
     attaccatct attggaatat cagctatacg ggtaagcagt tgtttatgaa ggttaaggct       180
     gaccttactg tcgcgaacaa cacgcttatc tctgttcaga agagtcagga aaagcagctg       240
     gaactcgtaa tggaatcatg ggaattccag aatgattttc gtctgttcga tggcaataaa       300
     aatagctatc gaaagcagat cgatcatttg ctcgattcca aaaaacagct gttaaattta       360
     gatttcttgc gtctggttag cgtgtcagag gccgctgccg atccagacct tcgcgtcatg       420
     cttcagaaag taaaaggtga ttctgcatat tcaggtttaa tggtactgga acctaagcgc       480
     ctggcattaa ttgatcctga gatggtgaag acggcaagta ttccattagt tgaaacgccc       540
     agatcacaaa aaccgactaa gaaagtcgaa gacaggggct tactcagtcg aagtttgttg       600
     cccgttcccg atgccgaagg caatgttgcc tggtacttag atggtgggat cttgtttaat       660
     cgggatattc gtatcgtcga tcacatcaga gatctggttt acgacaaggg gacactgccg       720
     gaacgatcta tcggcacagt gactatcttt ctcgacaata cgcgtatcag taccaatgtt       780
     cccctacatt ttttcccaca aggtggggaa gtcgaggggc gtgcattagg cagcttagta       840
     tctgaagagg ttaagcaaaa agttttttct cagggaatgc tctgggtcga cagagctttc       900
     gtgttcaatg attggtttat ctctgcttat gcaccactcg aggatgttca gggtaagcga       960
     atagggatga tttataccgg cttctcagaa tcgccattta ttcataatta cctacttaat      1020
     attatagagc tgggcaccat cttgatgttg gttttactgg tgtctggatt gctcgtctat      1080
     cgcggtgctt atagcttact tcagccaatt gagcgtattc atcacgtggt taaagcggtg      1140
     caatcaggac gaaacctgcg catcggatct ttggggcttg agcgagataa tgaattatca      1200
     aatttagccg agcaatttga ccgaatgctg gatctgctgc agcgccgaaa ttcgcaaatc      1260
     caggctgctg ccgagcagtt agaggtgaaa gttgaagagc ggacacgaag cctgcaggag      1320
     aaaacagagg aacttcaaaa caacgtggct ctgcttaatg agaccagaca acaactggtc      1380
     accaacgaga agcttaccgc actgggtgag ctgaccgcag gtattgccca tgagattaat      1440
     aatccgaccg cggtgatctt aggcaatatg gagttgatga aatatgagct aggcgatagg      1500
     gcggaggatg ttgaggagga gatcgatctc gtgatccaac aggtgggacg gatcagtacc      1560
     attatccgta gcctgctgca gtatagtcgc cctggtgagt tcaatgctcc acttgagatg      1620
     catcaactca ctccgattat cgaagagatg ttggtattgg tgcgccactc gattcaagag      1680
     cagaaggtga tattgaatca ggagttgaac gccagttatc cgatagaggt gaaccgtcct      1740
     cagttattgc aagtgttgat taatctcgtg gttaatgcgg cccatgcaat ggatgaagag      1800
     ggaaggatct ggatccgaac ctatgattgg gtccaaagag gtgaacctat cggggttaag      1860
     atcgaaattg aagatgaagg taaagggatc ccacaagagc agctgagtcg tatcttcgat      1920
     ccattctata ccaccagagc cgacggtacg ggtctggggc tatctttgag ttacggaatt      1980
     attaagcgta ttggtggaac gatagaggtc agctctacgg tgggcaaggg aacgctattt      2040
     accataggtt tatatcataa agctaaggag gagcaggtag atacccctta tgaggggctg      2100
     cactttaatg gtcattga                                                    2118
//

If you have problems or comments...

PBIL Back to PBIL home page