(data stored in ACNUC7421 zone)

EMBL: CP000821.PE128

CP000821.PE128       Location/Qualifiers
FT   CDS_pept        complement(142834..143499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0128"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_0086 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34741"
FT                   /db_xref="GOA:A8FPG8"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPG8"
FT                   /protein_id="ABV34741.1"
FT                   /translation="MLTLTNAQIRRALLVLVGFHILIICASNYLVQLPFQIFELHTTWG
FT                   AFSFPFVYLATDLTVRIFGQSAARRIILKAMIPALLISYLMGVIFHQGSFQGFTALSEF
FT                   NNFVFRIAFASFAAYLIGQLMDITVFAKLRNTQSWWVAPAASTLIGNLVDTLVFFSLAF
FT                   YASSDSFMAAHWPEIASVDYGFKLIVSLGLFLPAYGVLLKVLERKIVKLPTQQELATN"
     atgttaacgt taacaaatgc gcaaattcgc cgtgcactgc tggtgcttgt cggcttccac        60
     atactgatca tatgcgccag taactatttg gttcaactgc cttttcagat atttgaactt       120
     catactacct ggggagcatt cagctttcca ttcgtctacc ttgctaccga tctcaccgtc       180
     agaattttcg gtcaaagcgc ggccaggcgc atcattctaa aagcgatgat tccagccttg       240
     cttatctcat atttaatggg cgttattttt catcagggca gctttcaagg cttcacagca       300
     ctatctgaat tcaataactt tgtttttcgt attgccttcg ccagcttcgc cgcctacctc       360
     attggccagc tcatggatat caccgtcttc gccaaattaa gaaatacgca atcttggtgg       420
     gtagcacctg cagcatcgac ccttatcggt aacctggttg ataccttggt tttcttctcg       480
     ctagcttttt acgcctccag cgatagcttt atggctgcac attggcctga aatagccagc       540
     gtcgactatg gctttaaact gattgtaagc ttagggttgt ttctaccggc atatggcgtg       600
     ctattaaagg tactggaacg aaaaatcgta aaattaccaa ctcaacaaga actggccact       660
     aactaa                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page