(data stored in ACNUC7421 zone)

EMBL: CP000821.PE129

CP000821.PE129       Location/Qualifiers
FT   CDS_pept        143796..144581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0129"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34742"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPG9"
FT                   /protein_id="ABV34742.1"
FT                   /translation="MVISMKRLTLTTLLICLILLPSHLLANPTPLIEGPRVVTIATDSW
FT                   LGYTNRDGSGYYFDILKRVFPEKEWLLQIDIVPFSRVRYLVNHNRIDMALGFYSGDTTR
FT                   ALYSKNPVEVDSVDAAITPELAVIWKGAESLSQKKVQALLAYRYDEFISVPMYYEESSN
FT                   LLEMLNRVNRGQVDAVLDYKPVMLTMVPKLNQPRQFVIIENVFRTEIYFVFSDNDRGAK
FT                   LKRHFDRELKKLIDSGELDELFRHYVGPDAQRLDPGREQ"
     atggtcatct ctatgaagag actaacactt acgactttac tgatatgttt gattcttctg        60
     ccaagtcatc tcttggcaaa cccaactccg cttattgaag gccccagagt ggtgaccata       120
     gccaccgata gttggctagg ttataccaac agagatggaa gcggttacta tttcgatatt       180
     ctgaaacggg tatttcctga gaaagagtgg ctacttcaaa tcgatatagt gcccttttcc       240
     cgggtgaggt atttagtcaa tcacaatagg atcgatatgg ctttaggctt ctatagcgga       300
     gatacgacca gggctctata tagtaagaat cccgtcgaag tcgatagcgt ggatgcagcg       360
     ataactcctg agttggcggt catatggaaa ggggccgaga gcttgagcca gaagaaagtt       420
     caggcactct tagcataccg ttatgatgaa tttatctctg tacctatgta ctacgaggag       480
     agcagtaatc tacttgagat gctgaatagg gtaaaccgag gtcaggtgga tgcggtgctg       540
     gattataagc ccgtgatgct aactatggtg cctaagttga atcagcccag gcagtttgtg       600
     atcatagaaa atgtgttcag gacagagatc tatttcgttt tttctgacaa tgacagaggc       660
     gcaaagctaa agcggcactt tgatagagaa ttgaaaaaac ttatcgacag tggtgaactc       720
     gacgagctct ttcgtcatta cgtgggtccc gatgctcaaa ggctagatcc aggcagagag       780
     cagtga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page