(data stored in ACNUC7421 zone)

EMBL: CP000821.PE13

CP000821.PE13        Location/Qualifiers
FT   CDS_pept        14650..15705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0013"
FT                   /product="putative signal transduction protein"
FT                   /note="KEGG: sbl:Sbal_0011 putative signal transduction
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34626"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP53"
FT                   /protein_id="ABV34626.1"
FT                   /translation="MVIKLFQKIFNIRDNAVVSQPKSFSQNPELQQISSNKPKASLEPL
FT                   SAVEDSVDVSALFYSLLFPARQKDQGGVANNLEKNVIGDVERALSSPMAIAENVLKLPT
FT                   RMAELNKKLGDESVDIKVLLELMQKDPVLSVEVLKLCNSPVFKRSEREVTSLQQAFVQL
FT                   GRDQLRRFVTTSLVREMIEIKPIYYRRFGLQIWRHSMQVAFLSSELAGELSNDDPDTAF
FT                   MLGLLHDVGKIAIFKMLLDEFNLADPGEQPCSSLFRQVMTSKSLSLSALLARCWQLPAS
FT                   FEVTLNALANTSAKPTERLAAVVWRANLISECSMLHQAGKLDEFGLNRLLIDADLTREE
FT                   FDLFHEKLKEF"
     gtggtcataa aattattcca gaaaatcttc aatatcagag ataatgctgt cgtttctcag        60
     cctaaaagtt tcagtcagaa ccctgaatta cagcagatat caagcaacaa acctaaggcg       120
     agtcttgagc cgttaagtgc tgttgaagac tctgtcgatg tttcggcact cttctatagc       180
     ctgctttttc ctgcaagaca aaaagatcag ggaggggtcg ctaataactt agagaaaaat       240
     gtcatcggcg atgtggaacg agccttgtct tcgcctatgg cgattgcaga aaatgtgctt       300
     aagttgccga ctcgtatggc tgaacttaat aagaaactgg gcgatgaaag tgtcgatatc       360
     aaggtattac tcgaactcat gcagaaagat cctgtactga gtgtagaggt tctcaagcta       420
     tgtaactctc ccgtctttaa gcgttcagag agagaggtga caagccttca gcaagccttc       480
     gtgcagttag gtcgagatca attaaggcgt ttcgttacta cctctctggt acgggagatg       540
     atagagataa aacccatcta ttatcgacgc tttggtttac agatatggcg tcactctatg       600
     caggtggcat ttttgtcttc tgagttagcg ggtgagttgt caaatgatga tcccgataca       660
     gcctttatgt taggtctgct ccatgatgtg ggtaagatag ctatctttaa gatgttgttg       720
     gatgagttta acttagccga tcccggtgag cagccctgtt cctctctgtt tagacaggtg       780
     atgacctcta agtcattaag tttaagcgca cttctggctc ggtgttggca gttgccggca       840
     agttttgagg taactctgaa cgcattagcc aatacgagtg ctaagccaac cgaaagactt       900
     gccgccgtag tctggagggc taacttaatc agcgagtgct ctatgctaca tcaagccgga       960
     aagttagatg agttcggttt aaaccgttta ctcatcgatg cagatctaac acgggaagag      1020
     tttgatctct ttcatgagaa gctgaaagag ttttaa                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page