(data stored in ACNUC7421 zone)

EMBL: CP000821.PE131

CP000821.PE131       Location/Qualifiers
FT   CDS_pept        146463..148496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0131"
FT                   /product="TonB-dependent receptor, plug"
FT                   /note="KEGG: sbl:Sbal_0089 TonB-dependent receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34744"
FT                   /db_xref="GOA:A8FPH1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPH1"
FT                   /protein_id="ABV34744.1"
FT                   /translation="MKVQQKIIKMSAIALAIGSSGAVFADDIDRDPILNVNEVIVVHGE
FT                   RPTATEVATTHWSIDEDEIKALGAQSLEQVLKNVPGVYVRTGGQGTPRVDIRGFKTRHV
FT                   TLLINGVPANGAEDGQFDPSVIPTSQIASVEVSVGPTSVLYGPGGAGGVINIITKQGDD
FT                   ASTLSGRLEASGEDTFNGDISAAGSGDNWQGLVSVSHQQTNGFPLSGDYPHNDVQLDDV
FT                   RANSDKEIDNIYAQGSYWLSDNTQVTANMSLRSGQWGKPSRDGSGSGTVKFERADDYDA
FT                   KTFQLGMAHKFSEMFTLRGFGYHNQSDVLETQYTDSSYTKVKQSQDGRSKVQGGNLQFI
FT                   TNFGDVGLLTSSLIAENQSWESTTSKPSTGDKSSQKQSRVLDGYSGGSGGGNGGGSSNF
FT                   DDSAWLYTLAAEYQYQDDGYYGFTIGGALHDQDRVKESENDYSGQLSGFWQAFEQTRFN
FT                   AGIARKVRFPSMKNLYSQSSGNADLVAETSKHFELGVEQELGASTALSVAGYYTDAENY
FT                   IAKDMSGVYQNMGRYQFKGVDVSLNNQFIDDLSLTFVYSFLDTEDKDAFDGMGTLEYRP
FT                   RHQLRFQADYELPFAMRINMNIERIMGQVYYEQEKVNGNKVWTEQSLKDYTLLDLNLVQ
FT                   PVLDDKLELYIRATNLLDENYYQSDAIPQAGRQVFVGISWQI"
     atgaaagtac aacaaaaaat aataaaaatg tcggcaatcg cgcttgccat cggtagtagt        60
     ggagccgtat ttgcggacga catagataga gacccaatcc tcaatgtaaa cgaagtcatc       120
     gttgttcatg gcgagagacc gaccgcgaca gaagtggcta cgactcattg gagtatcgat       180
     gaggatgaga taaaagcgct gggggctcaa agcttagaac aagtgcttaa aaatgtgcct       240
     ggcgtatatg taagaaccgg cggacagggt acaccaaggg tagatattcg tgggtttaag       300
     acacgacacg ttaccttgct cattaatggt gtgccggcaa atggtgccga agatggccag       360
     tttgatccaa gtgtgatccc aaccagtcag atcgcttctg tcgaagtttc agtagggccg       420
     acatcggttc tttatggccc cggcggagcc ggtggtgtga ttaatatcat caccaagcag       480
     ggagatgatg cctctacttt gtcggggcga ttagaggcgt ccggcgaaga taccttcaat       540
     ggtgacatta gcgctgcggg gtcaggtgat aattggcaag gtttggtcag tgtcagtcat       600
     caacaaacga atggtttccc actgtcaggt gattatccac ataacgatgt tcagcttgat       660
     gatgtcaggg ctaactctga taaagagatc gataatattt atgctcaggg gagctattgg       720
     ttatcagaca atacccaagt aactgccaat atgagcctgc gttcgggcca gtggggcaag       780
     ccttcacgag atggtagcgg tagcggaacc gttaagtttg agcgggccga tgactatgat       840
     gcaaaaacct tccagttagg catggcacat aaattcagtg agatgttcac ccttagaggt       900
     ttcggttatc acaatcagag tgatgtgctg gagacacaat ataccgattc cagctatacc       960
     aaggtgaaac agagtcagga cggacgctca aaggtacagg gcggaaatct gcagtttatc      1020
     accaatttcg gtgatgtggg tttgctgacg agttctctta tcgctgaaaa tcagagctgg      1080
     gagtccacaa catccaagcc atcgacaggt gacaagtcga gtcagaagca gagtcgggta      1140
     ctcgatggct atagcggcgg aagcggtggt ggaaacggcg gtggaagcag caacttcgat      1200
     gactcggcgt ggctctatac cttagccgcc gaatatcaat atcaggatga tggctattat      1260
     ggtttcacca taggtggtgc tcttcatgat caagaccgtg tcaaagagtc tgagaatgat      1320
     tactcagggc agctgtccgg attctggcaa gcatttgaac agacacgttt caatgcggga      1380
     atcgcaagaa aagttcgctt cccttcgatg aagaacctgt actcacaatc ttcaggaaat      1440
     gccgatttag ttgcagaaac atctaaacat tttgaactcg gtgttgaaca agagctggga      1500
     gcatcgacgg cgctatccgt tgcgggctac tacaccgatg ccgagaacta tattgccaag      1560
     gatatgtcag gtgtctatca aaatatgggg cgctatcagt tcaaaggggt cgatgtgtct      1620
     ctgaataacc agttcattga cgatctgtca ttaacctttg tctatagctt tttggacacc      1680
     gaagacaaag atgctttcga tggcatgggg actttagagt atcgcccaag gcatcagctt      1740
     cgttttcagg cagattatga gcttcctttt gcgatgcgaa tcaacatgaa tattgaacgg      1800
     atcatgggac aggtctacta cgaacaggag aaggttaacg gtaataaagt ttggaccgag      1860
     cagtcattaa aagattacac cttgttggat ttgaacttag ttcaacctgt attggatgac      1920
     aagctggagc tctacatcag ggcgacaaac ttgttagatg aaaactatta ccaaagcgat      1980
     gccattcctc aggctggacg acaagtcttt gtcggcatta gctggcagat atag            2034
//

If you have problems or comments...

PBIL Back to PBIL home page