(data stored in ACNUC7421 zone)

EMBL: CP000821.PE133

CP000821.PE133       Location/Qualifiers
FT   CDS_pept        150025..150717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0133"
FT                   /product="cobalt transport protein"
FT                   /note="KEGG: sbl:Sbal_0091 cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34746"
FT                   /db_xref="GOA:A8FPH3"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPH3"
FT                   /protein_id="ABV34746.1"
FT                   /translation="MRAKGRHKATEYRGAAGFDHHRLERAAARKSGYITATSLILVLLL
FT                   SSGAFFLPDRYIPGLIACEICLVIHGVYRRGSLGVIARVFFVQLTITMSLYYLIHGQSQ
FT                   LAQGAVAVLRILLAFIPGWWLSITCAPERIGEVLTWVLPVKWAFVIAASISLLPYMTVE
FT                   LREIYHIQCLRGARINPKALRDPRNWSELINCVIFPVLIQLLKLSRQIAVAAQLRYFGK
FT                   SNQPTHWR"
     gtgcgggcta aaggcaggca taaggcaact gaatatcgtg gagccgcagg ctttgatcat        60
     catcgtcttg aaagggccgc ggcccggaaa agcggttata ttaccgccac ctctttaatt       120
     cttgtcttgt tattgtcgag tggcgctttt tttctcccgg acagatatat ccctggtttg       180
     atagcgtgcg aaatttgctt ggttattcat ggcgtatacc gtcggggaag tctgggcgtt       240
     attgcacggg tctttttcgt gcagctcact atcaccatga gtctatatta tcttattcat       300
     ggccagagtc agctggctca gggggcggta gcggtattaa ggatcttatt agctttcatc       360
     cctggctggt ggttatccat tacttgcgcc ccggaacgta taggtgaagt gctaacttgg       420
     gtactgccgg ttaagtgggc attcgttatt gcggcatcga tcagtttgct gccatacatg       480
     acagtcgaac tgcgtgaaat ctatcacatt cagtgtctgc gtggcgcgcg aataaaccct       540
     aaagccctga gggatccgag aaattggtct gaattaataa attgtgtgat ttttccagta       600
     cttattcagc tgcttaagct ttccagacag atcgctgtcg cggctcaatt acgatatttt       660
     ggtaagagta atcaacccac tcattggagg tga                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page