(data stored in ACNUC7421 zone)

EMBL: CP000821.PE134

CP000821.PE134       Location/Qualifiers
FT   CDS_pept        150785..151330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0134"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3673 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34747"
FT                   /db_xref="GOA:A8FPH4"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPH4"
FT                   /protein_id="ABV34747.1"
FT                   /translation="MSKSFNFSLQDALFIGFCATLLVALKSMLRLKLGISGHSMFLMTF
FT                   FYLICYGVVGRVGCISACGVLSGLVAMILSVGKGGPLILIKFALPAIAMDLSLLVFAGL
FT                   FTLRWRCVIVGLIGCLAWATKGWIEDLLVGMTMQVALVQFALSMLKGGMFTLFAALMVP
FT                   PVLERLKSHDLLYKESAK"
     atgagtaaga gttttaactt cagtttgcag gatgcactct ttatcggctt ttgtgccaca        60
     ttattggtgg cgctaaaaag catgttgcgt ctcaagctgg gcatctccgg gcattcgatg       120
     tttctgatga catttttcta tctcatctgt tatggcgtgg tgggacgtgt tggctgtatc       180
     tccgcatgtg gagtgttatc cgggctggtt gccatgatct taagtgtggg gaaagggggg       240
     ccattaatcc tcataaagtt tgcattgccg gctattgcga tggatttgag tctgctcgtg       300
     tttgcggggc tgtttaccct aaggtggcgc tgtgtgattg tgggtctgat aggttgtctt       360
     gcatgggcca caaaggggtg gatagaggat ctgttggtgg gaatgacgat gcaggtggct       420
     ttggttcagt ttgcgttgag tatgctaaaa ggtgggatgt ttaccctgtt cgcggccttg       480
     atggtccccc cagtgttaga gcggttgaag tcacatgatt tactctataa agagagcgca       540
     aaatag                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page