(data stored in ACNUC7421 zone)

EMBL: CP000821.PE135

CP000821.PE135       Location/Qualifiers
FT   CDS_pept        151331..152086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3672 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34748"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPH5"
FT                   /protein_id="ABV34748.1"
FT                   /translation="MNNKQLKSWLICIDDTDDIGTKGTGEIAQEIAEILSGDEHESCSF
FT                   ITRHQLYVHPDIPYTSHNSAMCFYLETNKSLAMIEQLAIAHLLEESAPASDPGLAILAC
FT                   DSGFDREALIHFGLEAKGQVKTKQDAYDLAMRLGVSLSEHGGTGQGVIGALAGIGLRLY
FT                   GQDGRVKGQIDLGQELYEEGVELTVEEVLTRSGLDIVVDLSGQQLKSTEVIHLTKKVKA
FT                   VYCQHQFALLVYRHEGRWCNALKRQLKEY"
     atgaataata aacagttgaa atcttggttg atctgtatcg atgatacgga tgatattgga        60
     actaaaggta cgggagagat agcccaagag attgccgaga ttctgtccgg tgatgaacat       120
     gaaagctgct cgtttatcac tcgtcatcaa ctctatgtac atccggatat tccgtacacc       180
     tcccataata gcgcgatgtg tttttattta gagactaata agtctctcgc gatgatcgag       240
     cagttggcta tcgcacacct gttagaagag agtgcgccag catccgatcc aggtttggct       300
     atcttggcat gtgattcagg gttcgacaga gaggcactga ttcattttgg tttagaggca       360
     aaaggccaag ttaagactaa gcaagatgct tatgatctgg ctatgagatt aggtgtcagt       420
     ttaagtgagc atggtggcac cggacagggc gttattgggg cgttggccgg tatcggatta       480
     aggctatatg gtcaggacgg tcgagtgaag gggcagattg acctgggtca ggagctttat       540
     gaagaggggg tagagctcac cgtggaagag gtattgacgc gcagcgggct ggatatcgtc       600
     gttgatttaa gtggtcagca actgaagagt actgaagtta ttcatttaac taagaaggtc       660
     aaagctgtgt attgccaaca tcaatttgct cttttggtat atcgtcacga gggtcgctgg       720
     tgtaacgcat taaagcgaca gttaaaggag tactga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page