(data stored in ACNUC7421 zone)

EMBL: CP000821.PE136

CP000821.PE136       Location/Qualifiers
FT   CDS_pept        152092..152310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0136"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3955 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34749"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPH6"
FT                   /protein_id="ABV34749.1"
FT                   /translation="MMQLKPWYQLEGKVFRFRFGTENSEASREAAQTCKQFSPDDEDEQ
FT                   IDDTLVSCYNCMNRRWLIDGVECIQFK"
     atgatgcagt tgaaaccttg gtatcagtta gagggaaaag tctttcgctt cagatttggc        60
     actgaaaata gtgaagcatc cagagaggct gctcagacct gtaagcaatt cagccccgat       120
     gatgaggatg agcagatcga tgacacgctt gtctcttgtt acaactgcat gaatcgacgc       180
     tggcttatcg atggcgtcga atgtatccaa tttaagtaa                              219
//

If you have problems or comments...

PBIL Back to PBIL home page