(data stored in ACNUC7421 zone)

EMBL: CP000821.PE137

CP000821.PE137       Location/Qualifiers
FT   CDS_pept        152571..153749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0137"
FT                   /product="HD domain protein"
FT                   /note="KEGG: son:SO4711 HD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34750"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR021812"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPH7"
FT                   /protein_id="ABV34750.1"
FT                   /translation="MADSVESKALVKFPVSKLTVGMFVTAIDRQGLVKISNAGQIRHRD
FT                   AIAKLVKNGIKHVWVDAERSAEHCGLKRAPSPKPVGKKPQQSREKSQKQAKKLIVEAKD
FT                   LVKKVLSETFEGKAIEVAPFGALADNMIESALLDADALKCVSALRTKDAYLLEHSINVA
FT                   FLLVTFGKYLKLEKDTLRQMAIGGMLHDIGKIKVDDKVLNKPGRLTPEEFEHIKLHQVF
FT                   AIDIMKETKGLSSISKDVCLMHHEKLDGNGYPKGLKGDELPLHGRMSCIVDIFDALTAT
FT                   RCYKEAMSPAAAFKVLLSLTPSHLDRALVYEFIRCVGVYPVGSLVELSDGRIGIVWQAS
FT                   NRDALHPILKCFYSIKHKRYTEVAMVDLLKSDLHIERGVSPSSLDVDPSPFY"
     atggcggatt cggtggaatc taaagcactt gttaaatttc cagtgtctaa attgacagtt        60
     ggtatgtttg ttaccgcaat tgatagacaa ggcttggtaa aaatttccaa cgccgggcag       120
     atccgtcatc gcgatgcgat tgctaaattg gttaagaatg ggattaagca tgtgtgggtc       180
     gatgctgagc gatctgcgga acattgtgga ttaaaacgtg caccatcacc taaacccgtt       240
     ggtaagaagc cccaacaatc tcgggaaaaa tcacaaaaac aagccaaaaa actgattgtc       300
     gaggctaaag atctcgttaa aaaagtccta tcagaaacct tcgagggaaa ggcgatagag       360
     gttgcacctt ttggagccct tgcagacaat atgattgagt ctgccttgct cgatgcggat       420
     gccttgaaat gtgtatcggc attgagaacg aaagatgcct atcttcttga acactctatc       480
     aatgttgctt ttttgctggt taccttcgga aaatacctca agttagaaaa agatacgctg       540
     aggcagatgg cgattggcgg catgctacat gatattggca aaattaaagt tgacgacaag       600
     gtgctaaata agccgggaag actcacaccc gaagagtttg agcatatcaa gctgcatcag       660
     gtttttgcca tcgatatcat gaaagagaca aaaggccttt cgagcatcag taaagatgtt       720
     tgtctgatgc atcatgagaa gctggatggt aatggttatc cgaaggggtt gaagggagat       780
     gagttgccgc ttcatgggcg catgagttgt attgtcgata tcttcgatgc ccttaccgca       840
     acccgttgtt acaaagaggc catgagtccg gccgctgcct ttaaagtact tctgagtctg       900
     acgccatctc atctggatcg agccttggtt tatgagttta ttcgttgtgt tggagtctac       960
     ccggtaggct cattagttga gttatccgat ggccggattg gtatcgtttg gcaagcgagt      1020
     aaccgagacg ccctgcatcc gatactcaaa tgtttctact caataaagca taagcgttac      1080
     accgaagtcg ctatggtcga tctgcttaaa tcggatctgc atattgagcg tggtgtctca      1140
     ccaagtagct tggatgtcga tccatctccc ttctattga                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page