(data stored in ACNUC7421 zone)

EMBL: CP000821.PE138

CP000821.PE138       Location/Qualifiers
FT   CDS_pept        153896..154564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0138"
FT                   /product="paraquat-inducible protein A"
FT                   /note="KEGG: sbl:Sbal_0097 paraquat-inducible protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34751"
FT                   /db_xref="GOA:A8FPH8"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPH8"
FT                   /protein_id="ABV34751.1"
FT                   /translation="MHRVLPIIVIFISLALLVPGVTQPILSLSGTIDKSELTLAGVDHL
FT                   ANSFSDDSAGSGSARGMISMITGMLGLNEIEGEVEVFQKTRSILGTIEELFQSGNAPVS
FT                   ALVMLFSIVIPALKLSVMLFLQFSVPEKVERHLNRFIALISKWSMADVFVVALMVSFMA
FT                   GNASAGMGELLRTTAKFEVGFYYFTAYCIFSILSTYLVTRRRRANTTGVEREAVLTSPQ
FT                   "
     gtgcatagag tactccccat tattgttatt tttatctcac tggcgttatt agtcccgggc        60
     gtaactcagc ctattttgag tctcagcgga acaatagaca aatctgaatt gaccttggct       120
     ggggtggacc atctggcaaa cagctttagt gatgactctg caggcagtgg aagtgccaga       180
     gggatgattt cgatgataac gggcatgctg ggactcaatg agatcgaagg cgaagtcgaa       240
     gtttttcaga agacgcggag tattttgggg accatagaag agctattcca atcgggtaat       300
     gccccggttt ctgctctggt gatgctgttt agtattgtta ttccggcgct gaaattaagt       360
     gtgatgttgt ttctgcaatt ttctgttccg gaaaaagttg agcgacattt aaatcgattt       420
     atcgccttaa tcagcaagtg gtcgatggcc gatgtttttg tcgtggcgct tatggtgagt       480
     tttatggccg gaaatgcatc ggctggcatg ggagagttat tgagaacaac cgcgaaattt       540
     gaggttggct tctactattt tacagcctat tgcatcttct ctatcttgag tacctatctg       600
     gtaacacggc gtcggcgtgc aaacactacg ggcgtagaga gggaagctgt gcttacttca       660
     cctcaatag                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page