(data stored in ACNUC7421 zone)

EMBL: CP000821.PE139

CP000821.PE139       Location/Qualifiers
FT   CDS_pept        complement(154595..157789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0139"
FT                   /product="Histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: neu:NE0049 sensory transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34752"
FT                   /db_xref="GOA:A8FPH9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPH9"
FT                   /protein_id="ABV34752.1"
FT                   /translation="MPFRLLTQWLSLTSIGSKVILSMAGISLLVLMLSASNFIMNTRVK
FT                   EDTTEVSTHEIPKAIAAINMLDEIGDMNSNILEYVLGEVDERDDFDQNQITFLQYLATL
FT                   KSALKAHDRRIDEIEELFNDFHTSARANVFNRYNPNNEAWAKQRVDGLTNVTGHKLEVL
FT                   LDSLKESEIKDVGSQPDLNEVIHDDLPGVRYYLELVDEAGDMTANLTEYISGIYEAKNA
FT                   FIENAQDFEEYLTKLQPLEQKPEEIALLAEVEALYKVLRDGGFEVFQRYNSSNKLEAIT
FT                   AIDELEHQTFARLERLLDDVSIDAERNTNLELLGLRQMTISNQYVLIVSLFLVLSLCIS
FT                   IIYFSYRIITRPITKLSSTMKQLADGDTEVDVVYRDRQDEVGNMAQAVEVFKTNMIARN
FT                   AAEQELVMAKDNAEAASKAKASFLATMSHEIRTPMNGIIGMIDLLLTSSLNRDQRSMTN
FT                   TIRDSSFSLLNIINDILDFSKIEAGKLELESLNFSISELLESVIDTITPNADEKRVTLE
FT                   LYTDPNIPHHIQGDPVRIRQVLFNLVGNAVKFSAVQDSRGEVRITLKKKELSNQLVFLT
FT                   IEIQDNGIGIEAKQLERLFQPFTQAESSTTRQFGGTGLGLAICQNLVNLMGGKIDVSST
FT                   VGKGSIFKVNLSFPYIERPSPLTHDYPKVIVIDDIHSEPLSVRVKEYLSSREVNLVSMP
FT                   YMNTSDHLRDNVETWAQVVIATDQLEQSRQQVEQNLTDAERKNIRFLVLKPTSRGDGII
FT                   DDNTFSIAASPLKISTLFYGLHVALGRESPLDSSAHEADTLSHTPLSITDAEKAGRLIL
FT                   VAEDNQTNQEVIKRQLSKLGYSCIVADDGVHAEELYPTYKFAMVLTDCHMPRRDGYELT
FT                   RVLRSMQKKSGIKVPIIAITANALVGESEKCIAAGMDDYLSKPVELVKLNKMLKKWLSS
FT                   SFKNSNDADKEQTDTERRYLDQGVISLVFADDREDYIAALSDFMEIILPQMKSMVKERN
FT                   FNISAIGELAHKLKSSAKTIGLLSIGDHCETIEAIAKEPDNQQARVSITERLDSIEDLL
FT                   PQIEKEITDVISSACR"
     atgccctttc ggcttttaac tcaatggctt tctctcacat ctatcggcag taaagttatc        60
     ctctctatgg ctgggatcag tcttctcgtg ctcatgctat cggcatcaaa tttcatcatg       120
     aatacacgag tgaaagagga tacgactgag gtcagtacac acgagatccc caaagctatc       180
     gcagcaatta atatgctaga cgaaatagga gatatgaatt ccaacatcct ggagtacgta       240
     ttgggagaag ttgatgagag agatgatttc gaccagaacc aaataacgtt tttacaatat       300
     cttgccacct taaaaagtgc ccttaaagca catgaccgcc gtatagatga gatcgaagag       360
     ttgtttaacg actttcacac ctccgcgaga gctaacgtgt ttaaccgtta taacccaaat       420
     aacgaagctt gggcaaagca aagagtcgat ggacttacta acgttaccgg ccataaactg       480
     gaagtgctat tagattcact caaggagagt gaaattaaag atgtcggatc acaacccgat       540
     ctcaatgagg tgatccatga tgatctaccc ggcgtgcgct actacttaga attagtcgat       600
     gaagccggag atatgacggc gaatttaact gagtatattt caggcatata tgaagccaaa       660
     aacgctttca ttgagaacgc tcaagatttt gaggagtatt tgactaaact acaacccctc       720
     gagcaaaaac ccgaagagat cgccctcttg gccgaggtag aagccctgta taaagtgctt       780
     agagatggcg gctttgaagt gtttcaacgc tataactcat cgaataagct cgaagcaata       840
     acggctatcg atgagctgga acatcagacc ttcgcccgat tagagcgttt attagatgat       900
     gtatccatag atgctgagag aaataccaat ctggagctat tggggttgag gcaaatgacc       960
     atctcaaatc aatatgttct tatcgtctca ctatttctgg tgctgtctct ttgtatcagt      1020
     attatctatt tctcctaccg gatcatcacc cgtcccatca ctaaactcag tagcacgatg      1080
     aaacagcttg ccgatggcga taccgaagtc gatgtcgtct atcgggatcg acaagatgaa      1140
     gtcggtaata tggcccaggc ggtggaagtg tttaaaacta atatgattgc ccgcaatgcc      1200
     gcagaacaag agctcgtcat ggcaaaagat aatgcagagg cggcatccaa ggcaaaagct      1260
     agctttcttg ccaccatgtc acatgagatc agaactccga tgaacggcat cataggaatg      1320
     atagatctgc tgctcacatc gagtctgaac cgagatcagc gcagcatgac caataccatt      1380
     cgcgactcct ctttttcact gctcaacatt attaacgata ttctggactt ctctaagata      1440
     gaggctggga aattagaact tgaaagtctc aacttttcca ttagcgaact actcgaaagt      1500
     gtcatcgaca caataacgcc caacgccgat gaaaaaaggg taactctgga actctataca      1560
     gaccccaata ttcctcatca tatccagggt gatccggtgc gaattagaca ggtgttattt      1620
     aacttagttg gaaatgcggt taagttttca gccgttcagg atagcagagg agaggttcgt      1680
     attactctca aaaaaaagga attgagcaat caactcgtct tcttaactat tgagatccaa      1740
     gataacggca taggcattga agccaaacaa ctggagagac ttttccagcc attcactcag      1800
     gccgaatcat ctacaacaag gcaattcggc ggtacgggac tggggctcgc catttgccag      1860
     aacctggtta acttgatggg gggtaaaatt gatgtctcca gcactgtggg taaaggctct      1920
     attttcaagg taaacctatc gtttccatat atagagcggc catcaccatt aactcatgat      1980
     tatccaaaag ttatagtcat cgatgatatt cattccgaac cgctatcggt aagagttaag      2040
     gagtacctaa gttcaagaga ggtcaacctt gtctctatgc cttatatgaa cacctctgat      2100
     cacctcagag ataatgtaga aacttgggca caagtcgtca tagccaccga tcagctagaa      2160
     caatcccggc aacaagtgga gcagaacctt accgatgcag agcgtaagaa catacgcttt      2220
     ctcgtactaa aaccaacatc caggggggat ggaataattg atgataatac cttctcgatt      2280
     gccgcatcac ctctaaagat aagcactctc ttctatggtc tacatgttgc cctgggtaga      2340
     gagagtccgt tagactcctc cgctcatgaa gccgatactc tatcacatac tcctctgtcg      2400
     attaccgatg ccgagaaagc gggacgctta atcctcgtcg ccgaagacaa tcagactaat      2460
     caagaggtga ttaagcgcca gctgagcaaa ctcggttact cctgtatcgt ggctgacgat      2520
     ggagttcatg ctgaggagct ttacccgacc tacaaattcg ctatggtatt aaccgattgt      2580
     catatgccca gaagagatgg ttacgagctg accagagtcc tccgaagtat gcaaaagaag      2640
     agtggcatca aggtgccgat tatcgcgatc acagccaatg ccctggtggg cgaatctgag      2700
     aagtgcatcg cagcaggaat ggatgattac ctctctaaac ctgtagaact ggtcaaactc      2760
     aacaagatgc taaaaaaatg gctatcctca tctttcaaaa acagcaatga tgcagataaa      2820
     gaacagactg acactgaaag acgctactta gaccaaggtg tcattagctt agtctttgcc      2880
     gatgacaggg aagactatat cgccgcattg tcagatttta tggagatcat cctgccacag      2940
     atgaagtcta tggttaagga gcgcaatttt aatattagcg ctatcggaga attagcccat      3000
     aaactcaaat cgtccgctaa aacgatcggc ttactctcaa taggcgatca ctgtgaaact      3060
     atcgaagcca tcgctaaaga gcctgataat caacaggcca gagtgagcat caccgaacga      3120
     ctcgactcga tagaagatct gctaccccag atagagaaag agatcacaga cgtgatctcc      3180
     agcgcctgtc gctag                                                       3195
//

If you have problems or comments...

PBIL Back to PBIL home page