(data stored in ACNUC7421 zone)

EMBL: CP000821.PE140

CP000821.PE140       Location/Qualifiers
FT   CDS_pept        158116..158796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0140"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="KEGG: slo:Shew_3669 ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34753"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPI0"
FT                   /protein_id="ABV34753.1"
FT                   /translation="MKRRDFLAAGTLAMATAMVSPQLFAATEDKPLQILALVFDDYETL
FT                   DLHGPVEMLGHMKNVQIKLVGDKSIIRSYQGPKVVTDISMDSVTPCDLFIVPGGLGTRK
FT                   LVEDEELMAWLRKQVSVSGKVFSICTGSALLAKAGILDGVNATTNKMAYQWVTGLAGQV
FT                   NWQPSARWVDDGKFLTSSGVSAGTDAALFYVSQLRGEVEARRIERLTEYHWNHDAKNDP
FT                   YAVS"
     atgaaacgtc gtgatttttt agctgcaggc actctggcca tggctaccgc tatggtatct        60
     ccgcaacttt ttgctgcaac tgaagataaa cctttgcaga ttctagcctt agtattcgat       120
     gactatgaaa ctctggatct acatggcccg gtagagatgt tagggcatat gaaaaatgtc       180
     cagattaagc ttgttgggga taagagtatt atcagaagtt atcaagggcc aaaagtggtg       240
     accgatatct cgatggatag cgtgactcct tgtgatcttt tcatcgttcc cggaggctta       300
     ggtacccgta agctcgtcga agatgaagag ctgatggctt ggctcagaaa acaggtcagt       360
     gtatcgggta aggtgttctc tatctgtacg gggtccgcac tgttggctaa agcgggtatc       420
     ttagatggtg ttaatgccac aacaaataag atggcctatc agtgggtgac gggattggcc       480
     gggcaagtta attggcaacc gagcgctcgt tgggttgacg atggtaagtt cctgacatca       540
     tccggtgtat cggcagggac tgatgctgca ctcttttatg tcagccagct aaggggggaa       600
     gttgaagcga gaagaatcga gaggcttacc gagtatcatt ggaatcatga tgcgaaaaat       660
     gacccctacg ccgtctctta g                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page