(data stored in ACNUC7421 zone)

EMBL: CP000821.PE141

CP000821.PE141       Location/Qualifiers
FT   CDS_pept        complement(159371..160315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0141"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spc:Sputcn32_3868 conserved hypothetical
FT                   protein 698"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34754"
FT                   /db_xref="GOA:A8FPI1"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPI1"
FT                   /protein_id="ABV34754.1"
FT                   /translation="MKLGTISFQTVKRHLPFFLIAVLCLLPVISSPIALVLGFTLASLG
FT                   LIPDEIDLGKSTKRLLSYSIIGLGFGIQLQTAISASMQNLPLILGSIIFTLLLGFILTK
FT                   ALKFDTKTGHLISAGTAICGGSAIAAVAPAINAKSEQSAIALATVFILNSVALFLFPAL
FT                   GHLFSMSQYDFGVWSAIAIHDTSSVVGAASAYGEEALTTATTIKLARALWIIPIALLSA
FT                   MAFGGDKKRITIPYFIGFYCLAIAIAHYFPQGQAVYEVLFELSKRVLVLCLFLIGAGIT
FT                   VRKMRAAGPKPLLLGVLLWLSIGTSSLLYILYL"
     atgaaactcg gcaccatatc ttttcagaca gtaaagcgtc accttccctt tttcttaatt        60
     gctgtcctat gtttacttcc cgtgatttca tcacccatag ccttggtatt gggtttcact       120
     ttagccagct tgggcctgat ccccgatgag atcgatctgg gcaagagcac taaacgtctc       180
     ctctcttact caattatcgg cctgggattc ggtattcagc tacaaaccgc catatcggcg       240
     agtatgcaga acctacctct gatcctcggc tctatcatct tcaccttgct cttaggtttt       300
     atactgacaa aagcactcaa gttcgacacc aaaacaggac acctgatctc tgcaggtacg       360
     gctatctgtg ggggaagtgc tatcgccgcc gtcgcaccag caatcaacgc caagagcgaa       420
     cagtcggcca tcgcactcgc caccgtattt attttaaact cggtggcact ctttctgttt       480
     cctgccctgg gtcatctctt ttccatgagc caatatgact ttggcgtctg gagcgctatc       540
     gcgattcatg acacctcttc ggtggtggga gcagcgtcgg cttacggtga agaggcattg       600
     actacggcaa caacgattaa attggctcgt gcattatgga tcattccgat agccctactc       660
     agtgccatgg catttggtgg tgacaagaaa cggatcacca tcccttattt catcggtttc       720
     tattgtctgg caattgccat cgctcactac ttccctcaag gacaggctgt ctatgaagta       780
     ctgtttgaat tatcaaagcg cgttctggtg ctttgcctgt tcctgatagg cgcggggatc       840
     actgtgagaa aaatgcgggc ggcaggccct aagcctctgc ttttaggggt tcttttatgg       900
     ttatcgatcg gaacgagttc gttactctac attctctatc tctaa                       945
//

If you have problems or comments...

PBIL Back to PBIL home page