(data stored in ACNUC7421 zone)

EMBL: CP000821.PE143

CP000821.PE143       Location/Qualifiers
FT   CDS_pept        complement(162024..162545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_4053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34756"
FT                   /db_xref="GOA:A8FPI3"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPI3"
FT                   /protein_id="ABV34756.1"
FT                   /translation="MSLLTQYTWFIKLATVASFSIIISVSTVSYSRADTKEPLPLGVVL
FT                   DSEGNPISLPSRNQSALEFHSPTITKPHHNPGVNPVPNKRTSKKKARSKKLSRKQQLTS
FT                   RAQIANDPSCRWLNSRMNKLEESLTSVGNRSANSYHKKELAVRNKEWKCMKCGAEGPEQ
FT                   KDYDRCQYRR"
     atgtcactct taactcaata tacttggttc attaaacttg cgactgtcgc cagcttctcc        60
     attatcatct cagtaagtac cgtttcctat agccgagccg acaccaaaga gcccctgcct       120
     ttaggcgtag tgctggatag tgaaggaaac cccatctccc tcccctcccg aaaccaaagc       180
     gctctggaat ttcactcgcc taccatcaca aaaccccatc ataaccctgg cgtaaatccg       240
     gttcccaaca aaaggactag caagaaaaag gctcgttcga aaaaactcag ccgcaaacaa       300
     caactcacca gcagagcaca gattgccaac gatccaagtt gccgctggtt aaacagtaga       360
     atgaacaaat tagaagagag cctcacatct gtcggcaatc gttcggctaa cagttatcat       420
     aaaaaagagt tagcagtccg gaacaaggag tggaaatgta tgaagtgtgg cgccgaaggg       480
     ccggagcaaa aagattatga caggtgccaa taccgccgct aa                          522
//

If you have problems or comments...

PBIL Back to PBIL home page