(data stored in ACNUC7421 zone)

EMBL: CP000821.PE144

CP000821.PE144       Location/Qualifiers
FT   CDS_pept        complement(162665..163441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3658 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34757"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPI4"
FT                   /protein_id="ABV34757.1"
FT                   /translation="MNNKFKFSLLTSLLITASTVYADTSANIDDSHSRNILPANEAVDT
FT                   NYLLDLGWDSKYVSEGRNNLDKGGIFWGTAAVQHGNLNVYATLGRADDQDYTEWNFGLE
FT                   YAIALSDTLEATVGYQRLEFYGDERANDNEFFSSLTYSGIKWLTPSIAYTYATEAGGYF
FT                   VEASLHSSWELLENFTVTPYVTQAFDFQYATEDHDGPNHFQFGLEAEYLVNDQIVLSGH
FT                   VSHTIAQEDIKAEAKADGIEGSLDQTYAGVHLTWNF"
     atgaacaata aatttaagtt ttcactactg accagcctgt taattactgc atcgacggtc        60
     tacgcagaca caagtgcaaa catagatgac tcacatagca ggaatatact tccggcaaat       120
     gaagcggtag atactaacta tctgctcgat ctgggttggg attcaaaata tgtctcggaa       180
     gggcgaaata atctggataa aggcgggata ttctggggca cagcagccgt acagcatggt       240
     aacttaaatg tctatgccac ccttggccgc gccgatgacc aggactatac cgagtggaac       300
     ttcggtcttg agtacgccat agccctatct gatactcttg aagcaacagt cgggtaccaa       360
     agactggagt tttacggtga tgaacgtgcc aatgataatg agttcttcag ctccctgacc       420
     tatagcggta tcaaatggct gacgccatcg attgcctata cctatgcgac agaagcgggt       480
     ggctattttg tcgaggccag cctacacagc agctgggagt tactcgaaaa cttcaccgtg       540
     acgccctatg tcactcaggc attcgatttt caatatgcaa ccgaagatca tgatggacct       600
     aaccatttcc aatttgggtt agaggccgag tacctggtaa atgatcaaat cgttttatcc       660
     ggtcatgtca gtcacaccat agctcaggaa gacatcaaag ctgaagcaaa ggccgacggt       720
     atcgaaggca gcttagatca gacttatgct ggtgttcatt taacctggaa tttctaa          777
//

If you have problems or comments...

PBIL Back to PBIL home page