(data stored in ACNUC7421 zone)

EMBL: CP000821.PE146

CP000821.PE146       Location/Qualifiers
FT   CDS_pept        complement(165926..166345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34759"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPI6"
FT                   /protein_id="ABV34759.1"
FT                   /translation="MKSIFSIFVLFISLSTLTACATSRPTSITVDDSDRLVEIKVSGNF
FT                   LEDELRFKSAKYDIRIQNLGDNLFHIDAKVISKRIDHLTGDELIASNQIVTQVKAEPEE
FT                   KVTIGGLDSWSESIQEDGSVIETRAEKRYVLQIMN"
     gtgaaatcta tattttcaat ttttgtatta ttcatctcat tatcgacgct gaccgcatgc        60
     gctacttccc gtccgacatc gataacggtt gacgattcgg ataggcttgt tgagataaaa       120
     gtttccggaa attttctcga agatgagttg agatttaaga gcgctaaata tgatattcgc       180
     attcaaaatt taggcgataa cctgttccat atagatgcta aagtcatatc taagagaatc       240
     gatcacctga ccggggatga actgatagcc agcaaccaga tagtcaccca agtcaaagca       300
     gagcctgaag agaaggtaac tattggtggc ctggattctt ggtcggagtc gattcaggag       360
     gatggaagtg tcatagagac tcgagcggaa aaacgatatg tcctgcaaat aatgaattaa       420
//

If you have problems or comments...

PBIL Back to PBIL home page