(data stored in ACNUC7421 zone)

EMBL: CP000821.PE147

CP000821.PE147       Location/Qualifiers
FT   CDS_pept        166663..167193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0147"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3934 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34760"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPI7"
FT                   /protein_id="ABV34760.1"
FT                   /translation="MNLYFRLFWLFIWRVRHCNSIDFLGTSRISYRALPLDCDINCHVT
FT                   NSRYPALMDLARTYMLAEMGLLKRFIKLKWLPIVNAAEFTYIRDIKPLTKFEIESKLVG
FT                   WDDKYFYIEQRFVSDNILHCIVHVRGVFVCKGKQVPIDTMVKEVNFEGPRPELPPEVVK
FT                   WKAFLQLKKERNI"
     atgaacctct atttcagact gttttggcta ttcatctggc gagttcgcca ctgtaactct        60
     atcgattttc ttggtaccag ccgtattagt tatcgtgcac tgcctctgga ctgtgatatt       120
     aactgccatg taactaattc tcgttatccg gcacttatgg acttggctcg tacatatatg       180
     ttggccgaga tgggactcct taagcgtttc attaagctga agtggttgcc tatcgtcaat       240
     gcggcagagt ttacctatat tcgggatatc aagcccctta ctaagtttga gatcgaatcc       300
     aagctggttg gctgggatga caagtacttc tatattgaac agcgctttgt cagtgacaat       360
     atcctgcatt gtatcgtaca cgtgcgaggc gtctttgttt gtaagggtaa gcaggtgccg       420
     atagatacta tggtgaaaga ggttaacttc gaggggccca gacccgagtt gccaccggaa       480
     gtggttaaat ggaaagcctt tctgcaacta aagaaagagc gcaatattta g                531
//

If you have problems or comments...

PBIL Back to PBIL home page