(data stored in ACNUC7421 zone)

EMBL: CP000821.PE148

CP000821.PE148       Location/Qualifiers
FT   CDS_pept        complement(167248..167898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0148"
FT                   /product="glutathione S-transferase, N-terminal domain"
FT                   /note="KEGG: slo:Shew_0027 glutathione S-transferase,
FT                   N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34761"
FT                   /db_xref="GOA:A8FPI8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPI8"
FT                   /protein_id="ABV34761.1"
FT                   /translation="MELFYHPLSRYSQKVLIALYEKQANFYPRVIELSDPLSRREFCDF
FT                   YPPGKLPLLKSKSGELIPESSIIIEFIDSEFSTGTRLFPIDRRIALDTRLQDRLIDNDF
FT                   SNVLFELEHQKLEDGDQNHIMIKQLENDISQFLGYLDKKLEKNHWLCSDGLTLADCALF
FT                   PCLHCAQDYFKLFQYDNLNRYWHQAQLRGSYLQVKEEVELAAGDVLSGRRPIP"
     atggaactgt tttaccaccc actttcccgt tattcacaga aagtactgat tgcgctctat        60
     gaaaaacaag ccaattttta tccacgggtt attgagttat cggatccact atccagacga       120
     gagttttgtg atttctatcc accgggaaag ctccccctgc ttaagagtaa gagtggtgag       180
     ctgattcctg agtccagcat aattatcgaa tttatcgata gtgagttttc taccgggaca       240
     cgactctttc ctatcgatag aaggattgca ctcgatacta gattacaaga tcgcttaatc       300
     gacaatgatt tcagtaatgt actcttcgaa ctggaacatc aaaaactaga ggatggcgat       360
     caaaaccata taatgattaa gcaacttgag aatgatatca gtcagtttct tggttatctg       420
     gacaaaaagt tagagaaaaa tcactggtta tgctcagacg gcttaacttt ggctgattgt       480
     gccctgtttc cctgtctgca ttgtgctcag gactatttta aactctttca atatgacaat       540
     ctgaatcgat actggcatca ggctcagctc agagggtcat atctacaggt caaagaggag       600
     gttgagttgg ccgcgggtga cgtactatct ggccgtagac ccattcctta g                651
//

If you have problems or comments...

PBIL Back to PBIL home page