(data stored in ACNUC7421 zone)

EMBL: CP000821.PE151

CP000821.PE151       Location/Qualifiers
FT   CDS_pept        complement(170152..170910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0151"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0030 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34764"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPJ1"
FT                   /protein_id="ABV34764.1"
FT                   /translation="MRTMTIQMKLQHKILLGGLLLSAASFAQAENEGEVLGGTISGNLT
FT                   FASDYVFRGESETMDGDVPVVQGTLGWGNDDGWYGGVFASNIKFADPNLEIVTAPYIGK
FT                   AGEFGDSGITYDVMVFSYLYPGASYSNYTELWMKVGKQFGQANIQLEVTPTIDDWFGVD
FT                   GWQGVNYSIHPSYAFKNGLKVSGSVGYQDLDGDNAEGWGHWNLGVSKAFYGLNFDLRYH
FT                   GSTVDETHKVYGTQTEIFDDRVVIGINKSF"
     atgagaacca tgactatcca gatgaaacta cagcacaaga tacttttagg cgggctacta        60
     ctctccgcag cttcatttgc acaagccgaa aatgaaggtg aagttctcgg tggaacaatc       120
     agtggaaacc tgacctttgc ttccgattat gtgttccgtg gcgagtcaga aaccatggat       180
     ggtgatgttc ctgtagttca aggtacactt ggttggggca atgatgatgg ttggtatggc       240
     ggcgtttttg cgtcaaatat caaatttgcc gatcccaacc ttgagatagt taccgcgcct       300
     tatatcggta aagccggtga gtttggcgac agcggtatca cttatgatgt catggtgttt       360
     tcatatcttt atccgggtgc ctcatactct aactacaccg aactctggat gaaggtcggt       420
     aagcagttcg gtcaggccaa tattcaactc gaagtgactc ccacgatcga cgactggttt       480
     ggtgtcgatg gctggcaagg cgttaactac tcaattcacc caagctatgc attcaaaaac       540
     ggactgaaag tatcgggttc cgtcggttat caagatcttg atggagacaa tgcggaagga       600
     tgggggcact ggaacttagg tgtcagcaag gcattttacg gcctgaactt tgacctcaga       660
     tatcatggca gtaccgtcga tgagacccac aaggtctacg gtacacagac agaaattttt       720
     gatgaccggg tagttatcgg catcaacaag agcttttaa                              759
//

If you have problems or comments...

PBIL Back to PBIL home page