(data stored in ACNUC7421 zone)

EMBL: CP000821.PE152

CP000821.PE152       Location/Qualifiers
FT   CDS_pept        171346..172503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0152"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: slo:Shew_0031 efflux transporter, RND family,
FT                   MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34765"
FT                   /db_xref="GOA:A8FPJ2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPJ2"
FT                   /protein_id="ABV34765.1"
FT                   /translation="MRQIVKIASVLSVALWITACGQKPEQGPQERGPMEVGVIKVEAQP
FT                   QSILVELPGRSKAYLEAEVRPQVSGIIMTRGFVEGRDVEKGQSLYQIDSSTYTAALISA
FT                   KADLQSAKANLVSAKAKALRFEKLVKLNSISEQDYDEADAAYKAALARVTVAEAAINTA
FT                   KINLEYTEVRAPIAGRVGKSSVTAGALVTANQTQTLATIQQLDPINIEIAQSSAQMLRL
FT                   KSKLKQGQLKAADNAGVQLILEDGTTYKHDGVLQFAEVSVNEDTGSVILRAEFPNPDGV
FT                   LMPGMYVRAVLNTGTDPEAILVPQRAITRNTKGEAVAMIIDAEGKVAARVVTTAEVIDH
FT                   QWRITDGLTVGDQLIVEGLQKIRPGAAVKAGPLVADKKSQAQQQK"
     atgcggcaaa tagtgaaaat tgcctctgtt ttaagtgtgg cgttatggat aacagcttgt        60
     ggacaaaaac ctgaacaagg gccacaggaa cgtgggccta tggaagtagg tgttataaaa       120
     gtagaggcgc agcctcaatc aattttggtt gagttgcctg gtcgtagtaa agcttatttg       180
     gaagcggaag ttcgtcctca agtcagcggt atcattatga ctcgcggctt tgtagaaggg       240
     agagatgttg aaaaaggtca atccttatat cagatcgatt catcgacata cactgcagca       300
     ctgatcagtg ctaaagcgga tcttcaaagc gcaaaagcca acttagtctc cgcgaaagca       360
     aaagcattac gttttgaaaa attggtcaag cttaactcta taagcgagca agactatgat       420
     gaagccgatg ccgcttacaa agcagcatta gcaagagtta cagttgctga agcggcgatc       480
     aatactgcaa agattaatct tgagtacacc gaagttcgtg cacctattgc cgggcgtgtg       540
     ggcaagtctt cagtgacagc cggtgcacta gttactgcaa atcaaactca aacattagcg       600
     accattcagc aactcgatcc cattaatatc gagattgcgc aatcgagtgc gcaaatgtta       660
     cgtctgaaat ctaagttaaa acagggccaa ctcaaggcgg ctgataacgc gggtgtgcag       720
     ctcattttgg aagacggtac aacatacaag cacgatggtg tgttgcagtt cgctgaagtg       780
     agtgtgaatg aggacacggg ttccgttatt ttgcgggctg agtttcctaa ccctgatggc       840
     gtgttaatgc ctggcatgta tgtgcgtgca gtgctcaata ccggtaccga tccagaagcg       900
     attttagtac cccaaagagc tatcacgcgt aataccaaag gtgaagccgt tgccatgatt       960
     atcgatgctg aaggtaaggt ggctgcgcga gtcgtcacga ccgctgaagt gatcgatcac      1020
     cagtggcgta ttactgatgg tttaactgta ggtgatcaac tgattgttga aggtctgcaa      1080
     aaaattcgcc ctggcgccgc cgtaaaagct ggaccgttag tggcggataa gaaatcacaa      1140
     gcacaacaac agaagtag                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page