(data stored in ACNUC7421 zone)

EMBL: CP000821.PE154

CP000821.PE154       Location/Qualifiers
FT   CDS_pept        complement(175802..176479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0154"
FT                   /product="glutathione S-transferase, C-terminal domain
FT                   protein"
FT                   /note="KEGG: sfr:Sfri_2500 glutathione S-transferase,
FT                   C-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34767"
FT                   /db_xref="GOA:A8FPJ4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPJ4"
FT                   /protein_id="ABV34767.1"
FT                   /translation="MNKPSALPVLYSLRNCPYAIRARMAIYVSGQAVQLRDIVLSDKPA
FT                   HMLQVSPKGTVPVLVLQNDKVLEQSLEIMMWAFGQSDPNNYLMSDSPNTRAEMLSLVDL
FT                   FDTEFKLRLEKYRSAKRYHDESVLEHRLACEQYLKMLELKLSQHTYLMSDSPSLADLAI
FT                   LPFIRQLARVERQWYLQSPYPNIRKWLNDYLQSRMFSKVMSKYPMWLTEKSLIVFSADK
FT                   PLS"
     atgaacaagc cctcagctct acctgtgctt tactctttgc gaaattgtcc ctacgccata        60
     cgcgctagaa tggctattta tgtttcaggc caagctgtgc agctgcgcga tatagtatta       120
     agtgataagc ctgctcatat gctccaggtc tcacccaaag gtactgttcc ggttttagtg       180
     ctgcaaaatg acaaggtgct ggagcagagc ttagagataa tgatgtgggc ttttggccaa       240
     agtgacccta acaactactt aatgagcgac agtccgaata cacgagccga aatgcttagt       300
     ttagtcgacc tttttgatac cgagtttaag ttacggcttg agaagtatcg cagcgcaaaa       360
     cgttatcatg acgaaagtgt attggaacat aggttagctt gtgagcaata tttgaaaatg       420
     ttggagctga agctatctca acacacatat ttgatgtcag atagcccaag cttagcggat       480
     ttagcgatat tgccatttat tcgacagttg gcccgagttg agcgtcagtg gtacttacag       540
     tcaccctatc ccaatattag aaaatggctc aacgattact tacaaagccg gatgttcagt       600
     aaagtaatgt ctaaatatcc gatgtggtta acagaaaaat ctttgatagt tttttctgct       660
     gataagccat taagttaa                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page