(data stored in ACNUC7421 zone)

EMBL: CP000821.PE157

CP000821.PE157       Location/Qualifiers
FT   CDS_pept        180321..180890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0157"
FT                   /product="LemA family protein"
FT                   /note="KEGG: slo:Shew_3652 LemA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34770"
FT                   /db_xref="GOA:A8FPJ7"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPJ7"
FT                   /protein_id="ABV34770.1"
FT                   /translation="MEGLLLGLGLLVIIAYLWYVSLVKKRNSVREALSGIDVQLKKRSN
FT                   LVPNILKIAQKFMDHEKSLLTEITELRAQVEKSYDIGDASAVKEHLVKAELLNGKMGQL
FT                   MVSVENYPELKSDNTMLQAMQTYNEVEAHISAARRFYNASVTELNNAVEIFPGSIIASM
FT                   ANIKVMPFYEADEASKAPVDASDYLN"
     atggaagggt tgctgttggg gttagggcta ctggttatca ttgcctacct ttggtacgtc        60
     agtctggtta aaaagcgcaa ttctgttcgc gaagctctat ccggtatcga tgtgcagttg       120
     aaaaaaagat ctaacctggt gcctaatatt ttaaaaattg ctcagaaatt catggatcat       180
     gaaaagtcct tattgactga gatcaccgag ctgcgtgccc aggtagaaaa atcttatgac       240
     atcggcgatg cgtcagctgt taaggagcat ctggttaaag ccgagctatt gaatggcaag       300
     atgggtcagt tgatggtgag tgtcgaaaac taccccgagc taaaatccga caacactatg       360
     ctacaagcga tgcagaccta taatgaggtt gaagctcata tctctgctgc tcgccgattc       420
     tacaatgcat cggtaactga gctaaataat gcggtggaga tcttccccgg ctcaattatc       480
     gcttctatgg cgaatattaa ggtgatgcct ttctacgaag ccgacgaagc ttcgaaggcg       540
     ccggtcgatg cctccgatta cctgaactaa                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page