(data stored in ACNUC7421 zone)

EMBL: CP000821.PE158

CP000821.PE158       Location/Qualifiers
FT   CDS_pept        180949..181959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0158"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3651 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34771"
FT                   /db_xref="GOA:A8FPJ8"
FT                   /db_xref="InterPro:IPR021484"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPJ8"
FT                   /protein_id="ABV34771.1"
FT                   /translation="MNIISFLFGARIKPKRQAKPLSAVGDELESLQAHYDEHIEPLTRK
FT                   FENRRVACLKALRLRIYMSIGIFAAVLFICLLFDSTQRIVIPWPFYLLPLVPLCWWCSR
FT                   PVTHYQSDVKLQVFPKIFRYFGDDFIFSPTHSMSMSTLKRSKLLPGYDKAHFDDYVQGT
FT                   HRGIEIAINELALTKEVRRDKRNETKTVFNGVMVQLGCHKKFNGHTVVVRNRGSLMNFL
FT                   SDSFKRLSRVKLEDPRFEKLFDVFSSDQIEARYLLTVSFMERLQELADCFSGQFQCAFY
FT                   EDKLLIMLASRENRFELGSIFHGATFEYEFSQINREMRQLFAMIEVLKLDEYTGL"
     atgaatataa ttagttttct ttttggtgca cgtattaagc ctaagcgcca ggcaaaacct        60
     ctgagtgccg tgggtgatga actcgagtcg ttacaggcgc attacgatga gcatatagag       120
     ccattgacgc gcaagtttga gaatcgtcga gtggcctgtc taaaggcact taggctgcga       180
     atatacatga gcataggtat ttttgctgcc gtgctcttta tctgtctctt atttgattcg       240
     acacagagaa tagtcatacc ttggcccttc tacttgttgc ccttggtccc cctttgctgg       300
     tggtgctcca gacccgtgac ccattatcag agcgatgtaa agctgcaggt atttcccaag       360
     atatttcgct attttggtga tgactttatc tttagcccaa cacacagcat gagcatgagt       420
     acgctcaagc gttcaaagct gctacccggt tacgataagg cccatttcga tgattacgtt       480
     cagggtactc accgggggat cgagatagcg atcaacgagc tggcgcttac taaggaggtc       540
     aggcgagata agcgtaacga aactaagacg gttttcaatg gtgtgatggt gcaactgggc       600
     tgtcataaga agtttaatgg tcacactgtg gttgtacgta acagaggtag tctgatgaac       660
     ttcctttctg actcctttaa gcggttgtcc agggtcaagc ttgaagaccc gcggtttgag       720
     aaattattcg acgtgttttc atctgatcag atcgaggccc gttatctatt gaccgtctct       780
     tttatggaac gcttacagga gctggcggac tgcttttccg gtcagtttca atgcgctttc       840
     tatgaagata aattactcat catgttagcc agcagagaaa accgattcga gctgggttcc       900
     atttttcatg gcgccacctt cgagtatgag tttagtcaga ttaacagaga gatgaggcaa       960
     ctgtttgcta tgattgaagt actgaaactc gatgaatata ccggtctgtg a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page