(data stored in ACNUC7421 zone)

EMBL: CP000821.PE159

CP000821.PE159       Location/Qualifiers
FT   CDS_pept        181968..182705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0159"
FT                   /product="lytic transglycosylase, catalytic"
FT                   /note="KEGG: slo:Shew_3650 lytic transglycosylase,
FT                   catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34772"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPJ9"
FT                   /protein_id="ABV34772.1"
FT                   /translation="MHAICCGGIVSSLLWLAGVTHSYAQVTIERDAKPHYKASYSKEGI
FT                   LGKSSTAHPASFSPSKEAENQLKVYQYRQENGVMAFSDHAPGSAQYQVLLYDCYACQPD
FT                   SSLDWKKIPLFYRDYDELINQAANTHNLDPALIRAVIHAESAFKVFALSRSGAMGLMQL
FT                   MPETAKELGVKNAFKPEQNIDGGAKYLAQMLRRFDGDIDLACAAYNAGPMNVTHYKGIP
FT                   PYPETQAYVKRVKILLERYRKPG"
     atgcatgcca tctgctgtgg tggcattgtc agctctctgc tttggcttgc gggcgtaacc        60
     cacagttatg ctcaggtcac tattgagagg gatgccaagc ctcattataa agccagttac       120
     tctaaagagg ggatattggg caagtcttct actgctcatc ctgcatcctt ctctccttcg       180
     aaagaggctg aaaaccagct aaaggtatac caatacaggc aggagaatgg tgtcatggca       240
     ttctccgatc atgctccggg ttcggctcaa tatcaggtgc tgttatatga ctgctatgca       300
     tgccagcccg actccagtct ggattggaag aaaatccctc ttttctacag agactatgat       360
     gagttaatca atcaagccgc caatacccat aaccttgatc cagcactcat tcgggcggtt       420
     attcacgccg aatcggcatt taaggtattt gccttgtccc gaagcggcgc catggggctg       480
     atgcaactta tgcccgaaac ggcgaaagag ttgggggtta aaaatgcctt caagccggag       540
     caaaatatcg atggcggggc aaaatatctg gcgcaaatgc tgcgacgctt tgatggggat       600
     atagatttag cctgtgccgc ctacaatgcc ggccccatga atgttaccca ttataagggg       660
     atcccgcctt accccgagac ccaagcctac gttaaacggg tgaagatctt gttggagcgt       720
     tatcgcaaac ccggctaa                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page