(data stored in ACNUC7421 zone)

EMBL: CP000821.PE162

CP000821.PE162       Location/Qualifiers
FT   CDS_pept        185416..185787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0162"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spc:Sputcn32_0958 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34775"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPK2"
FT                   /protein_id="ABV34775.1"
FT                   /translation="MHTSLKKKLVELELYLLKADVRVSVQDLDQLIHDDFLEFGGSGIS
FT                   FGKKEVLKQLPREKCPEFSATAFELRHLSCDVAQLVYRATMKKPGEFITRYSLRSSLWR
FT                   KSQGRWQMIFHQGTPCEPF"
     atgcacacca gtttaaagaa aaaacttgtt gagctggagc tctatcttct taaggcggat        60
     gtcagggtat cggttcagga tctcgatcag cttatccatg acgattttct cgagtttggc       120
     ggctctggaa taagcttcgg caagaaagag gtgttaaagc agctcccccg ggagaagtgc       180
     cctgaatttt cagctaccgc attcgaattg aggcatctct cttgcgatgt cgctcagctt       240
     gtctataggg caaccatgaa gaaacccggt gagtttatta cccgttactc actgcgcagc       300
     tcgctatgga gaaaaagtca ggggcgctgg cagatgatct ttcatcaggg gacgccatgc       360
     gaaccgtttt ga                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page