(data stored in ACNUC7421 zone)

EMBL: CP000821.PE163

CP000821.PE163       Location/Qualifiers
FT   CDS_pept        complement(185896..186738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0163"
FT                   /product="protein of unknown function DUF519"
FT                   /note="KEGG: slo:Shew_3648 protein of unknown function
FT                   DUF519"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34776"
FT                   /db_xref="GOA:A8FPK3"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPK3"
FT                   /protein_id="ABV34776.1"
FT                   /translation="MLSYRHGYHAGNYADVLKHSVLLQVLKLMHKKPTPFVYIDTHAGA
FT                   GGYALSDEFAQKTGEYLEGVAKLWGKEDLPEPLAEYIADVTHFNQGKPELSFYPGSPAF
FT                   VDMNSYEKERMVLHELHGADHAQLEEQFAGDRYIRIVKDDGLKGLIAAVPPRERRGVIL
FT                   VDPSYEMKTDYQDVPNAIIKAHKKFATGVYMLWYPVVNRAQTEGMLKILAQSGIKNQLR
FT                   IEQSVRADSDEFGMTAAGLWIINPPWQLDSKADEILEYLSPLLNQGGGKVTMKLEVGE"
     atgctgagtt atcgccacgg ctatcatgcc ggaaattatg ccgatgtatt aaagcactct        60
     gttttattgc aggtgcttaa gctaatgcat aagaagccaa ccccttttgt ctatattgat       120
     acccatgccg gagccggcgg ttatgctctg agtgatgaat tcgcccaaaa aaccggagag       180
     tacttagagg gtgtcgctaa gctatgggga aaagaggatc tacctgaacc acttgctgag       240
     tatattgctg atgtcactca cttcaatcag ggcaaacctg agctctcttt ctatcccggc       300
     tctccagcct ttgtagatat gaacagctat gaaaaagagc gcatggtatt gcatgagctt       360
     catggcgccg atcacgctca gcttgaagag cagtttgccg gtgaccgata tattcgcatt       420
     gtcaaagacg atggcttaaa agggttaatc gcagcggttc ctcctcgtga acgacgcggc       480
     gttatcttag tagacccaag ctatgagatg aaaaccgatt atcaggatgt gcctaacgcg       540
     ataattaagg cccataaaaa gttcgcaact ggtgtatata tgctctggta tccggtcgtt       600
     aaccgcgctc aaaccgaagg catgttgaaa atacttgctc agagtggcat taagaatcag       660
     ctacgtatcg aacagtcagt tagagccgat agtgatgaat ttggtatgac ggcggcgggt       720
     ctgtggatca tcaatccacc ttggcagctc gatagtaaag ctgatgagat tttagaatac       780
     ttatcacctt tgctaaacca aggtggcggt aaggtcacga tgaaattaga agtcggtgaa       840
     taa                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page