(data stored in ACNUC7421 zone)

EMBL: CP000821.PE164

CP000821.PE164       Location/Qualifiers
FT   CDS_pept        186935..187711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0164"
FT                   /product="protein of unknown function DUF548"
FT                   /note="KEGG: slo:Shew_3647 protein of unknown function
FT                   DUF548"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34777"
FT                   /db_xref="GOA:A8FPK4"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FPK4"
FT                   /protein_id="ABV34777.1"
FT                   /translation="MTELKQSIQPIGIFFNAQYPSLEAICQRWGLVFDKEAAFELVFEN
FT                   NCLVLNKRDEPKLKGISVDFVSGAVAHRRKFGGGRGQSIAKAVGLKQGVNPSVVDGTAG
FT                   LGRDAFVLASLGCNVTMVERNPVVAALLEDGLRRAYESEEIGDWMRERMRLVHGSSLES
FT                   VAELGEEIDVVYLDPMYPHREKSALVKKEMRVFQSLVGADLDADGLLAPATALATKRVV
FT                   VKRPDYAEDLDGVKPSMVISTKKNRFDVYVKAAMKA"
     gtgaccgaac ttaagcaatc aatacagccg ataggcatct tttttaatgc tcaataccct        60
     tcattagagg ctatctgcca aagatgggga cttgtctttg ataaggaagc tgcattcgag       120
     ctggtattcg aaaataattg ccttgttttg aataagcgtg atgaaccaaa actgaaaggc       180
     atcagtgtgg attttgtctc gggcgctgtg gcgcatcgcc gcaaatttgg tggtggacga       240
     gggcaatcga tagccaaagc ggtaggcctt aagcaagggg tgaatcccag cgtcgtcgat       300
     ggtaccgctg gcctcggacg tgatgccttc gtgctggcca gtcttggctg caatgttact       360
     atggtagagc gaaaccctgt ggttgcagcc ctgctcgaag atggtctgcg ccgcgcctat       420
     gaaagtgaag agatcggcga ttggatgcgc gagcgcatga gactggtaca cggctcgagt       480
     ctggagtctg tggccgagct tggcgaagag atcgatgtgg tgtacttaga tcccatgtat       540
     ccccaccgtg aaaagtcggc attagtaaag aaggagatgc gcgtatttca gtcactggtc       600
     ggcgccgatc tcgatgccga tggacttctc gcccctgcca cagcattagc cactaagcga       660
     gtggtggtca agcgacccga ttacgcagag gacttagatg gggtgaagcc atctatggtc       720
     atatcaacga agaaaaaccg tttcgatgtg tacgttaagg cggctatgaa ggcttaa          777
//

If you have problems or comments...

PBIL Back to PBIL home page