(data stored in ACNUC7421 zone)

EMBL: CP000821.PE165

CP000821.PE165       Location/Qualifiers
FT   CDS_pept        complement(187715..188101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0165"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34778"
FT                   /db_xref="GOA:A8FPK5"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPK5"
FT                   /protein_id="ABV34778.1"
FT                   /translation="MNRLVVSLALVFFAFILWVIYLANTGSTSVFFELVGVLPYGDKLG
FT                   HFCLFGMLTFLFNLASRCKSFPIGRFRLYYGTAVVTIFVLAEEISQGFIPSRTFDLMDL
FT                   TADALGILSFTYVTYLSSKTPMKA"
     atgaatagat tggtagttag tttagcgcta gttttttttg cttttattct ttgggtgatc        60
     tatctggcga ataccggtag cactagtgtt ttcttcgagc tggtaggtgt gctcccctat       120
     ggtgacaaac tggggcactt ttgccttttc ggtatgctga cctttttgtt taatctcgcc       180
     tctcgctgta agtcgtttcc gataggtcga ttccgtctct actatggtac tgcggtcgtt       240
     acgattttcg tgcttgcgga ggagattagc caaggcttca tccccagcag aacatttgat       300
     ctgatggatc tgaccgccga tgccctgggg atcctcagct ttacttatgt aacttatctc       360
     agcagtaaaa caccgatgaa ggcataa                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page