(data stored in ACNUC7421 zone)

EMBL: CP000821.PE166

CP000821.PE166       Location/Qualifiers
FT   CDS_pept        complement(188256..189107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0166"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3640 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34779"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPK6"
FT                   /protein_id="ABV34779.1"
FT                   /translation="MNKLTLGATIAVLGLSLNVNAEETSSPLAMSIISGMEAYEDSPGS
FT                   SLSKGAGISLIWDDLRYDKTYKLDTNYFRARGTYYYEKDSEKYDEDRYRDSMDLKLHYQ
FT                   RPFMSINNDDDYTLSVIGHYEGHYNSQQLEEFEQLAVGGLALNRRFGDTHHYDLGVTLG
FT                   LAFSEEEKDDDWPRESQGITEEELNRRGFGYYFELKNKYTFSHTGVQLSLNYSRYDGLW
FT                   KYEDNKSYTFNKVNFGVVIPLANKNNLLHFATEYIDRTSEQDLIGFDDVLYRVHAEYVH
FT                   YF"
     atgaataaat taactctcgg cgcgactatt gcggtattag gcctgtcact caacgtgaat        60
     gctgaagaga ccagctcccc gctggccatg tctataattt cgggtatgga agcctatgag       120
     gactcacccg gcagctcttt atcgaaaggc gccggcatct cactcatttg ggacgatctc       180
     agatacgata aaacctacaa gctcgatact aactacttcc gggctcgcgg cacctactat       240
     tacgagaaag attcagagaa gtacgatgaa gacagatatc gagactcgat ggatctaaag       300
     ctccattacc agcgtccttt tatgagcatc aataacgatg acgattatac tctcagcgtt       360
     atcggtcact acgagggtca ttacaacagt caacagctcg aggagtttga gcagcttgcc       420
     gtaggaggct tagcactcaa caggcgtttt ggtgacaccc atcattacga cttaggggtc       480
     accttaggct tggccttcag cgaggaggag aaagatgatg actggccgag agagtcacaa       540
     gggatcacag aggaagagct taaccgccgc ggtttcggtt actactttga actaaagaac       600
     aagtatacct tcagccacac cggagttcag ttatcactaa actacagccg ttacgatggc       660
     ctgtggaaat atgaagataa taagtcctat accttcaaca aggttaattt tggcgtcgtt       720
     attcctctag ccaataaaaa caacctgctg cacttcgcaa cagaatatat tgatcgcacc       780
     tctgaacaag atctgattgg attcgatgat gttctctacc gcgtgcatgc tgaatacgtt       840
     cactacttct ag                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page