(data stored in ACNUC7421 zone)

EMBL: CP000821.PE167

CP000821.PE167       Location/Qualifiers
FT   CDS_pept        complement(189301..190611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0167"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: slo:Shew_3638 integral membrane sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34780"
FT                   /db_xref="GOA:A8FPK7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPK7"
FT                   /protein_id="ABV34780.1"
FT                   /translation="MKWLKKFLPRSAFSQTVMLIGCLLLINQLVSYLSVATYFIQPTYQ
FT                   QINQLIARQVKLLFVDGVDIGREHLTMVDALNAKVRDDGMEIYNQKQAREAGIDQAVYY
FT                   GFLSSQMSEHLGGKAEVKIAQGDDFEIWIRPPQAPSIWIKVPLTGFNESDLSPLTLYLM
FT                   VIGALSVAGGWWFARQQNRPLKKLQKAAISVSMGDYPEPLPLTGSTEIVEVTNAFNQMS
FT                   HSMKQLEQDRALLMAGISHDLRTPLTRIRLASEMMVEEDEYLKDGIVHDIEDMDAIINQ
FT                   FISYIRQDQESTREQGQLNDLIEDVVQAESNREAKIEVELNECPEIPMQSIAIKRILSN
FT                   LVENAFRYGRGWVKLSSHFDGKRVGFSVEDDGPGIPEDQIPKLFQPFTQGDTARGSVGS
FT                   GLGLAIIKRITDRHQGEVVLTNRAEGGLRAQVWLPME"
     atgaagtggc tgaagaagtt cctcccccgt agcgctttta gtcagacagt catgctgatc        60
     ggttgtctgt tgctgatcaa tcagctggtg tcataccttt ctgtggccac ctattttatc       120
     cagccaacct atcaacagat caatcagttg atagcgcgtc aggtcaagtt gcttttcgtc       180
     gatggtgtcg atatcggccg tgaacacctc accatggtcg atgccctgaa tgccaaggtg       240
     cgtgacgatg gcatggagat ctacaatcag aagcaggcac gggaagcggg tatcgatcag       300
     gccgtatatt atggcttctt gtcatcacag atgtctgagc acttaggagg aaaagccgaa       360
     gttaagatag ctcagggaga tgattttgag atctggatcc gccctcctca ggctccctct       420
     atctggataa aggttccctt aaccggtttc aacgaatcag acttgtcccc actcaccctc       480
     tatctgatgg taattggtgc attgagtgtc gccggcggat ggtggtttgc cagacaacaa       540
     aacaggcccc tcaaaaagct tcaaaaagcg gcaatatcgg tctcgatggg cgactatccc       600
     gagccattgc ctctcacagg ctccaccgaa atagtcgaag tgaccaacgc ctttaatcag       660
     atgtcccata gcatgaaaca gctcgaacag gacagggccc tgttgatggc ggggatatcc       720
     catgatcttc gcacgccact gacccgcatc cgtctggcct ctgagatgat ggttgaagaa       780
     gatgagtacc tcaaagacgg catagtgcac gatatcgaag atatggatgc catcatcaat       840
     cagtttattt cctatatccg ccaagatcag gaaagcaccc gggaacaggg acagcttaac       900
     gatttgatag aggatgtggt gcaggccgaa tcgaaccgag aggcaaagat tgaagtcgaa       960
     ctcaatgaat gccccgagat ccccatgcag agcatcgcca tcaagcgcat actcagtaac      1020
     ctggtcgaaa atgcctttcg atatggtaga ggctgggtaa aactgagctc tcatttcgat      1080
     ggcaaacggg tgggtttcag tgtcgaagac gatggccccg gcattccgga agatcaaatc      1140
     cccaaactgt ttcaaccttt tactcaggga gatacggcga ggggcagcgt gggctcgggt      1200
     ctggggcttg ccatcatcaa acgaattacc gatcgccatc agggggaagt cgtactcacc      1260
     aatcgagccg aagggggttt acgcgctcag gtttggttac ctatggagta g               1311
//

If you have problems or comments...

PBIL Back to PBIL home page