(data stored in ACNUC7421 zone)

EMBL: CP000821.PE17

CP000821.PE17        Location/Qualifiers
FT   CDS_pept        19576..20742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0017"
FT                   /product="Chloramphenicol O-acetyltransferase"
FT                   /EC_number="2.3.1.28"
FT                   /note="KEGG: ppr:PBPRA3400 putative transport permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34630"
FT                   /db_xref="GOA:A8FP57"
FT                   /db_xref="InterPro:IPR024989"
FT                   /db_xref="InterPro:IPR026032"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP57"
FT                   /protein_id="ABV34630.1"
FT                   /translation="MSHKSAAFIWCSNYVFQFFFCFGIFLPFYQLWLSEQGMGSESIGI
FT                   ILAVGLMSRCVASIVGGILAKHESQYQNVLRVVSALGLCTAVSMVYWSPSFYHLLILTV
FT                   LFNAAIAPVFGLSDAIIATLDKRKILSYGPTRMWGSLGFVGATVVGGYCFELWTISVLP
FT                   IILIISCSLMLFSVTLKCPDLQTARSQHKVLEEDGKHWLGAELILLLGILSLLQGSHGF
FT                   FYGFSSVYWQEIGIAEGVIGYLWGISIVSEILVFIFAKKAFSNVSPKLLLQIASAGVLV
FT                   RWGALSLAEQPLYIALSQTLHGVTFAMTHLAAIKSIQLYLPESQMAKFQGLYNGLYMAV
FT                   TALVTFITGYLFDSLKADLFIAMALFGVVGFVLTFSLNLKPIKNPVTV"
     atgagtcata aaagcgctgc ctttatttgg tgttctaact acgtctttca gttcttcttt        60
     tgttttggaa tttttctccc tttttatcaa ctctggttga gtgagcaggg gatgggaagt       120
     gagagcatag gtattattct ggccgtgggc ttaatgagtc gctgcgtagc aagcatagtc       180
     ggtgggatat tagccaaaca tgagagtcag taccaaaacg tactaagagt ggtcagcgct       240
     ttgggtttgt gtaccgccgt ctctatggtt tattggagcc cgagttttta tcatctgttg       300
     atactcacgg tattgtttaa tgccgccata gctcctgtgt ttggattatc cgatgcaatt       360
     atagctacct tagacaagag aaaaattctc agctacggac cgacccgcat gtggggatcg       420
     cttggttttg tcggtgcaac tgtggttggt ggctattgct ttgaactctg gaccatcagt       480
     gttctgccta tcattctcat catcagctgt agcctgatgc tcttttcggt aactctaaag       540
     tgccctgatc tgcagacagc tcggtcgcaa cataaagttt tagaagaaga tggaaagcac       600
     tggcttggtg ccgaacttat cctcttgttg ggaatattat ctttactgca gggaagtcat       660
     ggcttctttt acggattcag ctccgtatat tggcaagaga taggtatagc agaaggggtt       720
     attggatacc tgtggggaat atctatagtc agtgagattc tggtgtttat ctttgctaag       780
     aaggctttta gtaatgtgtc gcctaagctg ttacttcaaa ttgccagtgc tggggttctt       840
     gtgcgttggg gagcgctctc acttgctgag caacctttgt atatcgcatt gagtcaaaca       900
     ctgcatgggg tgacgtttgc tatgacccat cttgcagcaa ttaagtctat tcagctgtac       960
     ctgcccgaat ctcagatggc aaaatttcaa ggtttgtata acggtctata tatggcggtg      1020
     acggcactcg ttaccttcat cacaggttac ctgttcgata gccttaaagc cgatctgttt      1080
     atcgcgatgg cgctttttgg tgtggttggg tttgtgctca ccttttcttt gaatctgaaa      1140
     ccgatcaaaa atcccgtcac ggtataa                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page