(data stored in ACNUC7421 zone)

EMBL: CP000821.PE171

CP000821.PE171       Location/Qualifiers
FT   CDS_pept        193063..194862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0171"
FT                   /product="thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding"
FT                   /note="KEGG: slo:Shew_3635 thiamine pyrophosphate enzyme
FT                   domain protein TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34784"
FT                   /db_xref="GOA:A8FPL1"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPL1"
FT                   /protein_id="ABV34784.1"
FT                   /translation="MSPSIKDNFGSEYYNSLPLFGDCLGELLAFFGVKRAYGVGGDFVA
FT                   NLINSLEGHIEVLPSSNEMHAGFSACAQAELNPLGMCLTTYTVGSLPCVTAAALARTEG
FT                   LPVVFISGAPGEAEVNSHALHHSVHPHTAWHTDLDAALNSFRALGVRAERLQGQRHSGQ
FT                   PNIAAEQCLELLTYAYLNRQPVFIEIPRDLINQPTQSLSLPLSLEQISQNQPLSLSGAE
FT                   LIAQDIESKLKLANKPLVFLGEKLRLNRPLLSKIISLCHQHSLPYATSWFGKGMLDESE
FT                   PLCLGSYNGAFSELEGKHYIESQADYILELGTAIFPSDTNNAFSSQTHAIDTHSHKTML
FT                   RGTARWEKDIEAVIDLLVQKLPLNEGAESTLDPDEKVTPPLESVMLGYHNLAETINQAQ
FT                   RQLAKPYIFVPEVGSSLFASFELETHGSDIGRSYLANPWYAAMGTCLPYARAIADQLAE
FT                   SNSLQPVLVMIGDGGFNFQANELINLQKQGANVTILYMRNNIFHLGKAGDAPIYSCNDQ
FT                   GFNPRLLIQAYGGDGHLCETTEQLTHCLIETAHKGGVHLIEVPTSVEAGHQSETTKKLN
FT                   TYIGFRNGDPQATERWNELCGHF"
     gtgtccccgt cgattaaaga taactttggt agtgagtatt acaacagttt gccacttttt        60
     ggcgactgtc tgggtgagtt attggccttt tttggggtga aacgagctta tggtgtcggt       120
     ggtgattttg tcgcaaacct gatcaactca ttagaggggc atatcgaagt gttgccctcg       180
     agcaatgaga tgcatgccgg gtttagtgcc tgcgctcagg ctgaactgaa tcctctgggg       240
     atgtgtttaa cgacctatac ggtcggcagt cttccgtgcg tgacggctgc cgcactggcg       300
     agaaccgagg gcttacctgt ggtctttatc tccggtgcgc ccggtgaggc agaggtcaat       360
     agccatgccc tgcaccattc ggtacaccca catactgcct ggcatacgga cctcgatgcg       420
     gccttaaact cttttcgtgc tctgggtgtc agagccgagc gtcttcaggg gcagagacat       480
     agcggtcagc cgaatattgc cgccgaacag tgtttggagt tgctcaccta tgcctacctg       540
     aaccgccagc cggtatttat cgagatccca agagatctga tcaatcagcc gactcaatct       600
     ctgagcctgc cactgagttt ggagcagata tcacagaatc agccacttag tttgagtggt       660
     gccgagctga tcgcccaaga tatcgagtca aagctcaagc tggctaacaa gcctttggtt       720
     tttttgggtg agaaactgag gttgaatcgc ccgctactct ctaaaattat ctcattgtgt       780
     catcaacata gcttgcccta tgcgacgagt tggttcggta agggaatgct ggatgagagt       840
     gagcctctct gtttaggcag ttataacggt gccttcagtg aactcgaggg taagcattat       900
     attgaatctc aggccgacta tattttggaa ttagggacgg caatatttcc ctcggatacc       960
     aataatgcat ttagcagtca gacccatgcc atagacaccc atagccataa aaccatgttg      1020
     cgaggaacgg cgcgatggga gaaggatatc gaggccgtta tcgatcttct agtgcagaag      1080
     ttaccgttaa atgagggggc tgaaagcact ctggatccgg atgaaaaagt aactccgcca      1140
     ctcgagtccg ttatgcttgg ttatcataac ttagcggaga cgattaatca ggctcagcgt      1200
     cagcttgcta agccttatat cttcgtgccc gaagtgggga gctctctgtt tgccagcttc      1260
     gaactggaga cccatggaag tgatatcggc agaagctatc tggccaaccc ttggtatgcg      1320
     gccatgggga cctgtcttcc ttacgcaaga gccattgcgg atcaacttgc cgaaagtaac      1380
     agcctgcagc cggtattagt catgattggg gatggtggtt ttaattttca ggctaatgaa      1440
     ctgatcaacc tgcagaagca gggcgccaat gtgacgattc tctatatgag aaacaatata      1500
     ttccacctgg gtaaggccgg tgatgctcct atctattcct gtaacgatca agggtttaat      1560
     ccaagattac tgatccaggc ctatgggggg gatgggcatc tgtgtgagac aacagagcaa      1620
     ctcactcact gtctgattga gacggctcac aaggggggag tacacctgat cgaggttccg      1680
     acttccgtgg aggcagggca tcagagcgag acgactaaga agcttaacac ctacataggc      1740
     tttagaaatg gcgatcctca ggccaccgag cgatggaatg agctgtgtgg ccatttctga      1800
//

If you have problems or comments...

PBIL Back to PBIL home page