(data stored in ACNUC7421 zone)

EMBL: CP000821.PE172

CP000821.PE172       Location/Qualifiers
FT   CDS_pept        195071..195442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34785"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPL2"
FT                   /protein_id="ABV34785.1"
FT                   /translation="MDKTQYFYRTAIFTRKDNQVSLVDIEKPDDTTPMEDWMAIVVSLA
FT                   DGRHTVNELIAYMGSQYRSAPQELEDTLHSVLERLQEGKIVQLSEQAVELPYYLAEPIE
FT                   SLDIEKAKKLIKEDGYIHH"
     atggataaga ctcagtattt ttatcgtacc gccattttca cacgcaaaga taatcaggtg        60
     tcattggttg atattgagaa gccggacgat acgactccga tggaagattg gatggcgata       120
     gtggtatcac tcgccgatgg tcgccatacg gtgaatgagt tgattgctta tatgggctct       180
     cagtatcgca gtgcaccaca ggagttagag gatacgctgc attcagtgct ggaaaggctg       240
     caggagggga agatagttca actgagtgag caggcagtcg agcttcccta ttatctggcc       300
     gagcctattg aatctctgga tattgaaaag gcgaagaagc tgatcaaaga ggatggttat       360
     attcatcatt ga                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page