(data stored in ACNUC7421 zone)

EMBL: CP000821.PE173

CP000821.PE173       Location/Qualifiers
FT   CDS_pept        195536..197950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0173"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="KEGG: slo:Shew_3634 RNA binding S1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34786"
FT                   /db_xref="GOA:A8FPL3"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPL3"
FT                   /protein_id="ABV34786.1"
FT                   /translation="MLSLAPLKSFYPGTTQLLMQMTQNIAQIIAQELNVREQQVTSTIT
FT                   LLDDGATVPFVARYRKEATGGLDDTQLRTLNSRLSYLRDLNDRRAVILSSIDTQGKLTP
FT                   ELKKALVDADSKTRLEDLYLPYKPKRRTKGQIAIEAGIEPLADYLFGNRQADIELEAGK
FT                   FINAEAGFADSKSVLDGARFIIMERFAEDAALLQKVRQHLSQNSVLESKMVKGKEKEGA
FT                   KFRDYFEHTEKLSKIPSHRALAMLRGRNEGMLSLSMNADPDNESKQSSYCAVIIADHFK
FT                   LNLTDSAVDQWLKTVVTATWRIKIALQMETEFLAKMREQAESEAINVFAKNLGDLLMAA
FT                   PAGAKATLGLDPGLRSGVKVAIVNNTGKLTAHTTIFPHAPQNQWDKSVRTLANLAKMHK
FT                   VELIAVGNGTASRETDKLAGELIASVKAELPGLTKIMVSEAGASVYSASELAANEFPDL
FT                   DVSIRGAVSIARRLQDPLAELVKIEPKSIGVGQYQHDVSQSQLSQSLEGVVEDCVNGVG
FT                   VDLNMASAPLLSQVAGLNKTLARNIVTYRDENGQFKQRKQLLKVARLGPKAYEQAAGFL
FT                   RIVDGDNPLDASSVHPEAYSLVESIAKAKDQALDTLMGNSELLRSLKAEDFITEKFGLP
FT                   TVTDILTELDKPGRDPRGEFKTATFKEGVEEVKDLKLDMILEGVVTNVTNFGAFVDVGV
FT                   HQDGLVHISSLTDKFVSDPHTVVKAGDVVKVKVMQVDVERKRIGLSMRLDEKAADMPAG
FT                   RSNQKSQTGSKPAAKSNQQGKGKPQHRSQPKQQANAAMGNAFADAFAKLKK"
     gtgctatctt tggcaccact caaatctttc tatccaggca cgacacaact tcttatgcaa        60
     atgacgcaaa atattgccca aatcatcgct caggaactga atgttcgcga acaacaagtc       120
     acctctacta tcaccttact cgatgatggt gcaacggtac ctttcgttgc gcgttaccga       180
     aaggaggcga cgggagggtt ggatgatact cagttgcgta cgttaaatag caggttgagt       240
     tacctgcgtg atctgaacga tagaagagcg gtgatcctat cgagtatcga tactcaggga       300
     aaactgaccc ctgaattgaa aaaagccttg gtcgatgccg acagtaagac gcgtttagaa       360
     gatctttacc tgccttacaa gcctaagcgt cgcactaagg gccagatagc aatcgaagcg       420
     ggcatcgagc ctttggctga ttatttattc ggtaaccgac aggcagatat tgaactcgaa       480
     gcgggtaaat ttatcaatgc agaagcgggg tttgccgaca gtaagtccgt tctcgatggg       540
     gcgcgtttca ttatcatgga gcgttttgct gaggatgccg cgctgctgca aaaggtaagg       600
     caacatctta gccaaaactc tgtgctcgag agcaagatgg tgaaggggaa agagaaagag       660
     ggcgcgaaat tccgtgacta ctttgagcat acagagaagc taagcaagat accgtcgcat       720
     cgtgcattgg ctatgctacg cggtcgaaat gagggaatgc tgagtttaag catgaatgcc       780
     gacccggaca atgagtctaa gcaaagcagt tactgcgccg ttatcatcgc cgatcacttt       840
     aagcttaacc tgaccgatag tgcggtagac cagtggctga aaaccgtagt cacggcaacc       900
     tggcgtatca agatcgcact acagatggaa accgagtttc tcgctaagat gcgtgaacag       960
     gctgaatctg aggcaatcaa cgttttcgcc aagaacctgg gcgatcttct gatggccgct      1020
     cctgcaggag ccaaggccac attagggcta gatccaggcc ttagaagcgg tgtgaaggtg      1080
     gctatcgtga acaacacggg taagctgacg gcacatacga ctatcttccc ccatgctcca      1140
     caaaaccaat gggacaagtc tgttcgcacc ttagcgaacc ttgccaagat gcataaggtt      1200
     gagctgatcg cggtaggtaa tggtaccgct tcgagggaaa cggataagct ggcgggagag      1260
     ctgatcgcca gtgtgaaagc cgagctacct gggttaacta aaattatggt gagtgaggcg      1320
     ggagcctcgg tctattcggc ctctgaatta gcggccaatg aatttcccga tcttgatgtg      1380
     tctattcgtg gcgccgtgtc tatcgcccgc cgtctacaag atccgctcgc cgagctggtt      1440
     aagatcgagc ctaagtcgat cggagtcggg cagtatcaac atgatgtcag tcagagccaa      1500
     ctgtctcagt ctctggaagg ggtagtggaa gactgcgtta acggtgttgg cgtcgatctc      1560
     aatatggctt ctgcgccctt gctatcacaa gttgctggtt tgaataagac attggctaga      1620
     aatattgtga cttaccgaga tgaaaatggt caatttaaac agcgtaagca gctacttaag      1680
     gttgctcgtt taggccctaa agcctatgag caggcggcgg ggttcctgcg cattgtcgat      1740
     ggcgataacc cgttagacgc ttcctctgtg cacccggaag cctattcgct ggtggaatcc      1800
     attgctaagg caaaagatca ggccttagac actttaatgg gtaacagtga attgctacgt      1860
     agcctgaagg ctgaagattt cattaccgaa aaatttggcc tgccaaccgt cacagatatt      1920
     ctgactgaac tcgacaaacc cgggcgagat ccacgtggtg agtttaagac cgccaccttt      1980
     aaagagggag tcgaagaggt taaagatctt aaactcgata tgatcttaga gggtgtggtg      2040
     accaatgtga ctaacttcgg tgccttcgtc gatgttggag ttcaccagga tggattggtg      2100
     catatctctt cactgacgga caagtttgtc agtgaccctc acaccgtcgt taaggcgggt      2160
     gatgtagtga aggtcaaggt gatgcaggtc gatgtcgagc gcaagcgtat cggccttagc      2220
     atgcgtctgg atgagaaggc cgctgatatg cctgctggtc gttctaacca aaaatctcag      2280
     acagggtcta agcctgctgc taaatcgaat cagcaaggca aaggcaagcc tcagcataga      2340
     tctcagccaa aacagcaagc caatgctgcc atgggcaacg ctttcgccga tgcctttgca      2400
     aaattgaaga agtaa                                                       2415
//

If you have problems or comments...

PBIL Back to PBIL home page