(data stored in ACNUC7421 zone)

EMBL: CP000821.PE175

CP000821.PE175       Location/Qualifiers
FT   CDS_pept        complement(200314..200817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0175"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3631 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34788"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPL5"
FT                   /protein_id="ABV34788.1"
FT                   /translation="MLVVTNYPQVPIATTNAATDSARTDNQQRPPVIPPKELTKGHEER
FT                   SFTPQHERTAEQADAQARLNERVQGKQQGTGQQHQEGKQQDQAKHAAPLLIKDLLRGKP
FT                   ALQRRDIQTSQQAVSPTPQKTDNERAIILDQPSEFYREFGQRVESFYQQQTHPHDEPAI
FT                   SALI"
     atgttagtgg tcacgaatta tccacaggtg ccgatagcga caactaatgc cgctactgac        60
     tctgcacgca cggataatca gcagagacca cccgttatcc cacctaaaga gttaactaag       120
     ggccacgaag agcggtcctt tacacctcag cacgaacgca ccgccgagca agccgatgct       180
     caagccaggt taaatgagag agttcagggt aaacagcaag gtaccggaca acagcatcag       240
     gaaggtaaac aacaagatca ggcgaaacac gccgctcctc tgcttatcaa agatctgctg       300
     agaggaaaac cagcgcttca acgacgtgat attcaaacca gtcagcaagc agtcagccca       360
     actccccaga aaacagataa tgagagagcc attatcttag atcaaccttc ggagttttat       420
     cgggagtttg gccaaagggt cgagagtttt tatcagcaac agactcatcc acatgatgag       480
     cctgccatat ccgcacttat ttaa                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page